KEGG   Mus musculus (mouse): 319984
Entry
319984            CDS       T01002                                 

Gene name
Jph4, 9330157P13Rik, JP-, JP-4, JPH, JPHL1
Definition
(RefSeq) junctophilin 4
  KO
K19530  junctophilin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    319984 (Jph4)
SSDB
Motif
Pfam: MORN Alanine_zipper
Other DBs
NCBI-GeneID: 319984
NCBI-ProteinID: NP_796023
MGI: 2443113
Ensembl: ENSMUSG00000022208
Vega: OTTMUSG00000027953
UniProt: Q80WT0
Position
14; 14 C3
AA seq 628 aa
MSPGGKFDFDDGGCYVGGWEAGRAHGYGVCTGPGAQGEYSGCWAHGFESLGVFTGPGGHS
YQGHWQQGKREGLGVERKSRWTYRGEWLGGLKGRSGVWESVSGLRYAGLWKDGFQDGYGT
ETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRRTSLDSGHSDPPTPPPPLPLP
GDEGGSPASGSRGGFVLAGPGDADGASSRKRTPAAGGFFRRSLLLSGLRAGGRRSSLGSK
RGSLRSEVSSEVGSTGPPGSEASGPPIPAPPALIEGSATEVYAGEWRADRRSGYGVSQRS
NGLRYEGEWLGNRRHGYGRTTRPDGSREEGKYKRNRLVHGGRVRSLLPLALRRGKVKEKV
DRAVEGARRAVSAARQRQEIAAARAADALLKAVAASSVAEKAVEAARMAKLIAQDLQPML
EAPGRRPRQDSGGSDTEPLDEDSPGVYENGLTPSEGSPELPSSPASSHQPWRAPACRSPL
PPGGNWGPFSSPKAWPEEWGGPGEQAEELAGYEAEDEAGVQGPGPRDGSPLLGGCSDSSG
SLREEEGEDEESLPQLRAPGGSESEPVTTPVLRGLSSRGPDAGCLTEEVEEPAPTERPAQ
PGAANPLVVGAVALLDLSLAFLFSQLLT
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgtcccccgggggcaagttcgactttgacgacgggggctgctacgtggggggctgggag
gcggggcgggcacatggctacggcgtgtgcaccgggcccggcgcccagggagagtacagc
ggctgctgggctcacggcttcgagtcgctgggtgtcttcacggggcccggcggacacagt
taccagggccactggcagcagggcaagcgcgaagggctgggcgtggagcgcaagagccgc
tggacctaccgcggcgagtggctgggcgggctgaaggggcgcagcggcgtatgggagagc
gtgtccggcctgcgctacgccgggctctggaaggacggcttccaggacggctacggcacc
gagacctactcggatggaggcacttaccaaggccagtggcaagccgggaaacgccacggc
tacggggtgcgccaaagtgtaccctaccaccaggcggcgcttctgcgctcaccccgccgc
acctccctggactccggccacagcgaccccccgacgccgcctccacccctacccctacca
ggagatgaaggaggcagcccagcctccggctcccgaggcggcttcgtgctggcggggcca
ggggacgccgacggggcgtcttcccgtaagcgcaccccagcagcaggtggattcttccgc
cgttcactgctgctcagcgggctccgggctggtgggcgccgcagctccctgggcagcaag
aggggatctctacgcagcgaggtgagcagcgaagtgggcagtacaggacccccgggctcc
gaggccagcgggcccccaatcccagctccacctgccctcatcgagggctcagccactgag
gtgtacgccggtgagtggcgtgcggaccggcgcagtggctatggagtgagccagagatcc
aacgggctgcgctacgaaggcgagtggctgggcaaccgacgccacggatacgggcgcacc
acccggcccgatggctcccgtgaggagggcaagtacaagcgtaaccggctggtacacggg
ggacgtgtccgcagcctcctgcctctggcccttagacggggcaaagtcaaggagaaagtg
gacagggctgtcgaaggtgcccgtcgagctgtgagtgctgcccgccagcgccaggaaatt
gcggctgccagggcagcagacgccctcctaaaagcagtggcagccagcagcgtcgcggag
aaggctgtggaggctgcgcggatggccaagctgatagcccaggatctacaacccatgtta
gaggccccaggccgcagacccagacaggactcaggaggttctgacacagagcctttggat
gaggacagccctggggtatacgagaatggactgaccccctcagagggctctccggaacta
cccagcagccccgcctcctcccaccaaccttggcgagcccctgcctgccggagtccactg
cctcctggagggaactggggccccttctccagccctaaagcttggcccgaggagtggggg
ggtcctggtgagcaggcagaggaactagctggctatgaggctgaggatgaggctggggtg
cagggtccaggaccaagagatggttccccacttctcggaggctgcagtgacagttcagga
agtcttcgagaggaggagggggaagacgaagagtccttgccccaactgagggccccagga
ggctcagagtctgagcctgtcaccacgccagttttgaggggcctgtcttcaaggggtcct
gatgctgggtgcctgacagaagaggttgaggagcctgctcccaccgagaggcctgcccag
ccgggagctgccaaccccctggtggtgggagccgtggccttgctggacctcagcctggcc
ttcctgttctcccagctcctcacctga

DBGET integrated database retrieval system