KEGG   Mus musculus (mouse): 319996Help
Entry
319996            CDS       T01002                                 

Gene name
Casc4, D130060C09Rik, VGFG2573
Definition
(RefSeq) cancer susceptibility candidate 4
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: TolA_bind_tri FAM76
Motif
Other DBs
NCBI-GeneID: 319996
NCBI-ProteinID: NP_001192298
MGI: 2443129
Ensembl: ENSMUSG00000060227
Vega: OTTMUSG00000015386
UniProt: Q6P2L7
Position
2; 2 E5
AA seq 435 aa AA seqDB search
MVGFGANRRAGRLPSFVLVVLLVVIVVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVAR
GRLEKRNSDLLLLVDTHKKQIDQKEADYGRLSSRLQAKEGLGKRCEDDKVKLQNNISYQM
ADIHHLKEQLAELRQEFLRQEDQLQDYRKNNTYLVKRLEYESFQCGQQIKELRAQHEENI
KKLADQFLQEQKETHKIQSNDGKELGRNDHGAPKNIPNVPENDANKNEDPSSNHLPHGKE
QLKRVGDAGMPGVEENDLAKVDELPAALKKPPVLASQHESHQTISHLPTGQPLSPNMAPG
SHLNQNENPSTSKQNPSNPLQHIIPGPNLDREPRIQTDTLKQATRDRANDFHKLKQSRFF
DENESPVDPQHGSKLADYNGDDGNVGEYEADKQAELAYNEEEDGDGGEEDVQDDEERELQ
MDPADYGKQRFSDVL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtttcggggccaaccggcgggccggccgcctgccgtccttcgtgctggtggtg
ctactggtagtcatcgtcgtccttgccttcaactactggagcatctcctcccgccacgtt
ctgcttcaggaggaggtggccgagctgcagggccaggtccagcgcaccgaggtggcccgc
gggcgcttggagaagcgcaattcggacctcttgctcttggtggacacgcataagaagcag
atcgaccagaaggaggccgattacggtcgcctcagcagccggctgcaggccaaggaaggc
ctggggaagagatgcgaggatgacaaggttaagctacaaaacaacatatcatatcagatg
gcagacatacatcatttaaaggagcaactggctgagcttcgtcaggagtttcttcgacag
gaagatcagcttcaagactacaggaaaaataatacctaccttgtcaagcggctagaatac
gagagttttcagtgtggacagcagatcaaggagttaagagcacaacatgaagaaaatatt
aaaaaattagcagatcagtttttgcaggaacaaaaggagactcataagattcaatcaaat
gatggaaaagaattgggtagaaacgatcatggagcacctaaaaatattccaaatgtgcct
gaaaatgatgcaaataagaatgaagacccctcaagcaatcatcttccccatgggaaagaa
caactcaaacgagttggtgatgcagggatgcctggagtagaagagaatgacctagcaaaa
gtagacgagcttcctgctgctttaaagaagccccctgtgttagcttctcaacatgaaagt
catcagacaatctcccatcttccaactggacagcctctctcaccaaacatggctccaggt
tcacatctaaaccagaatgaaaatcccagtacttcaaaacagaacccttcaaatcctctt
cagcacataattccaggcccaaacttggatcgggaacccagaattcaaacagacacgtta
aagcaggccaccagggacagagccaatgatttccacaagttgaagcaaagccggttcttt
gatgagaatgaatcccctgttgatccgcagcatggctctaaactggcggattataatggg
gatgatggtaacgtaggtgagtatgaggcagacaagcaggctgagctggcttacaatgag
gaagaagatggtgatggtggagaggaagacgtccaagatgatgaagaacgagagcttcag
atggatcctgcagactatggcaaacagcgcttcagtgatgtcctttaa

DBGET integrated database retrieval system