KEGG   Mus musculus (mouse): 320007
Entry
320007            CDS       T01002                                 

Gene name
Sidt1, AW045928, B830021E24Rik
Definition
(RefSeq) SID1 transmembrane family, member 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SID-1_RNA_chan
Other DBs
NCBI-GeneID: 320007
NCBI-ProteinID: NP_932151
MGI: 2443155
Ensembl: ENSMUSG00000022696
Vega: OTTMUSG00000026174
UniProt: Q6AXF6
Position
16; 16 B4
AA seq 827 aa
MLDCLRLALLCALPWLLRAAVPGHQEEPLAKSAELRRDPRDPARGADFDRVYSGVVSLST
ENIYSFNHTSHPGQVTAVRVHVNSSSDNLDYPVLVVVRQQKEVLSWQVPLLFQGLYQRSY
NYQEVSRTLCPSKATNETGPLEQLIFVDVASMAPHGAHYKLLVTKIKHFQLPTNVAFYFT
ASPSQPQYFLYKFPEDVDSVIIKVVSEKAYPCSVVSVQNIMCPVYDLDHNVEFNGVYQSM
TKKAAITLQKKDFPDEQFFVVFVIKPEDYACGGSFSIQENENQTWNLQRSKNLKVTIVPS
IKESVYVKSSLFSIFVFLSFYLGCLLVVLVHHVRFQRKSIDGSFGSSDGSGNMAVSHPIT
ASTPEGSNYGAIDESSSSPGRQMSSSDGGQPCHSDTDSSVEESDFDTMPDIESDKNVIRT
KMFLYLSDLSRKDRRIVSKKYKIYFWNIITIAVFYALPVMQLVITYQTVVNVTGNQDICY
YNFLCAHPLGVLSAFNNILSNLGHVLLGFLFLLIVLRRDLLHRRALEAKDIFAMEYGIPK
HFGLFYAMGIALMMEGVLSACYHVCPNYSNFQFDTSFMYMIAGLCMLKLYQTRHPDINAS
AYSAYASFAVVITLTVLGVVFGKNDVWFWIIFSAIHILSSLALSTQIYYMGRFKIDLGIF
RRAAMVFYTDCIQQCSRPLYMDRMVLLIVGNLVNWSFAFFGLIYRPRDFASYMLGIFICN
LLLYLAFYIIMKLRSSEKVLPLPVFCIAATAVVWAAALYFFFQNLSSWEGTPAESREKNR
ECVLLDFFDDHDIWHFLSATALFFSFLVLLTLDDDLDVVRRDQIPVF
NT seq 2484 nt   +upstreamnt  +downstreamnt
atgctggactgcctgcgcctggcgctgctctgcgcgctgccctggctcctgcgggcggcg
gtccctggccaccaggaagagcccctcgcgaaatccgcagagctgcggcgcgatccgcga
gaccccgccaggggagcggatttcgatcgcgtctacagcggggtggtgagcctcagcacc
gagaacatctactccttcaaccacaccagccatcctggccaggtgacagccgtgcgggtg
catgtcaacagttcctctgacaacctggactacccagtcctggttgtggttcgccagcag
aaagaagtgttgtcctggcaggtccctctgctcttccaaggactataccaaaggagctac
aactaccaggaagtcagccgcactctatgcccttcaaaagcaaccaatgagacgggccct
ttggagcagctgatctttgtagatgtagcgtccatggcgccccatggtgcccactacaag
ttgctggtcaccaaaatcaagcacttccagctcccgacgaatgttgccttctacttcact
gccagcccctctcaacctcagtattttctatacaaatttcctgaagacgtggactccgtt
atcattaaagtggtgtctgagaaggcttacccgtgttcagttgtctccgttcagaacatc
atgtgtccagtgtatgatctggaccacaatgtggaattcaatggtgtctatcagtccatg
accaagaaagccgccatcacgctgcagaagaaggattttccagatgagcagttcttcgtg
gtgtttgtgataaaacctgaagattatgcctgtggcggatcattctccatccaggaaaat
gaaaaccagacctggaatctacaacgatcaaagaacctgaaagtgaccattgtcccatcc
atcaaagaatctgtatatgtgaaatctagtcttttcagcatattcgttttcttgtccttc
tacttgggatgcctgctcgttgtgcttgtccatcatgtgaggtttcagaggaaatctatt
gacggaagctttggttccagcgatggctctggaaatatggctgtctcacatcccatcact
gccagcacgcccgaagggagcaattatggggcaatagatgagtccagttccagtcctggg
aggcagatgtcttcttccgatggtgggcagccttgccactcagacacggacagctctgtg
gaggagagtgactttgataccatgcctgacatcgaaagcgacaaaaacgtcatccggacc
aagatgttcttgtacctgtcagatctgtccaggaaggaccggaggattgtcagcaaaaag
tataagatttatttttggaacatcatcaccatcgctgtgttttatgcactgcctgtgatg
cagcttgttatcacctaccagacagtggtgaatgtcactggcaaccaggatatctgttac
tacaacttcctttgtgctcaccccctgggtgtcctgagcgccttcaataatattctcagt
aacctgggccacgtactcctgggcttcctcttcctgctgatagttctgcgcagagacctt
ctccaccgaagagccctggaagctaaagacatctttgctatggaatacggtattcccaaa
cactttggtctcttctacgctatggggatagcactgatgatggagggcgtgctcagtgct
tgttaccatgtctgccctaattactccaacttccagttcgacacttccttcatgtacatg
atcgctggcctctgcatgctgaagctctatcagacccgccacccggacatcaacgccagc
gcctactctgcttatgcctccttcgctgtggtcatcacactgacggtcctcggagtggtg
tttggaaaaaacgatgtgtggttctggatcatcttctctgccatccacattctctcttct
ctggccctcagcacccaaatctactacatgggccgtttcaagatagatctgggaatcttc
cggcgggctgctatggtgttctacacggactgtatccagcaatgcagcagacctctgtat
atggacaggatggtgttgctcattgtgggaaatctggttaattggtcctttgccttcttt
ggattgatctaccggcccagggactttgcctcctacatgctgggcatcttcatctgcaac
ctgctgctgtacttggctttctacatcatcatgaagcttcgaagctctgagaaagtcctc
ccgctaccagtcttctgcatcgcggccactgccgtggtgtgggctgcggcactgtacttc
ttcttccagaacctcagcagctgggaggggacccctgcagaatcccgggagaagaaccgt
gagtgtgtcctgctggatttctttgatgaccatgacatctggcacttcctctctgcgact
gccctgtttttctcattcctggtgctgttgaccctggatgatgacctggatgtggtccgg
agagaccagatccctgtcttctga

DBGET integrated database retrieval system