KEGG   Mus musculus (mouse): 320011
Entry
320011            CDS       T01002                                 

Symbol
Uggt1, 0910001L17Rik, A930007H10Rik, AA589501, AI414429, AI448372, C820010P03Rik, GT, UGT1, Ugcgl, Ugcgl1
Name
(RefSeq) UDP-glucose glycoprotein glucosyltransferase 1
  KO
K11718  UDP-glucose:glycoprotein glucosyltransferase [EC:2.4.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    320011 (Uggt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    320011 (Uggt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     320011 (Uggt1)
Glycosyltransferases [BR:mmu01003]
 Others
  Quality control
   320011 (Uggt1)
SSDB
Motif
Pfam: Glyco_transf_24 Thioredoxin_14 Thioredoxin_15 Thioredoxin_12 UDP-g_GGTase Thioredoxin_13 Glyco_transf_8
Other DBs
NCBI-GeneID: 320011
NCBI-ProteinID: NP_942602
MGI: 2443162
Ensembl: ENSMUSG00000037470
Vega: OTTMUSG00000037695
UniProt: Q6P5E4
Position
1; 1 B
AA seq 1551 aa
MCSRGDANTADAAAARRVTGLRYNMRLLIALALPCLFSLAEANSKAITTSLTTKWFSAPL
LLEASEFLAEDSQEKFWSFVEATQNIGSSDHHDTDHSYYDAVLEAAFRFLSPLQQNLLKF
CLSLRSYSASIQAFQQIAVDEPPPEGCKSFLSVHGKQTCDLDTLESLLLTAADRPKPLLF
KGDHRYPSSNPESPVVILYSEIGHEEFSNIHHQLISKSNEGKINYVFRHYISNPSKEPVY
LSGYGVELAIKSTEYKAKDDTQVKGTEVNATVIGESDPIDEVQGFLFGKLRELYPALEGQ
LKEFRKHLVESTNEMAPLKVWQLQDLSFQTAARILAASGALSLVVMKDISQNFPTKARAI
TKTAVSAQLRAEVEENQKYFKGTIGLQPGDSALFINGLHIDLDTQDIFSLFDTLRNEARV
MEGLHRLGIEGLSLHNILKLNIQPSETDYAVDIRSPAISWVNNLEVDSRYNSWPSSLQEL
LRPTFPGVIRQIRKNLHNMVFIIDPVHETTAELISIAEMFLSNHIPLRIGFIFVVNDSED
VDGMQDAGVAVLRAYNYVAQEVDGYHAFQTLTQIYNKVRTGETVKVEHVVSVLEKKYPYV
EVNSILGIDSAYDQNRKEARGYYEQTGVGPLPVVLFNGMPFEKEQLDPDELETITMHKIL
ETTTFFQRAVYLGELSHDQDVVEYIMNQPNVVPRINSRILTAKREYLDLTASNNFYVDDF
ARFSALDSRGKTAAIANSMNYLTKKGMSSKEIYDDSFIRPVTFWIVGDFDSPSGRQLLYD
AIKHQKTSNNVRISMINNPSQEISDSSTPIFRAIWAALQTQASSSAKNFITKMAKEETAE
ALAAGVDIAEFSVGGMDVSLFKEVFESSRMDFILSHALYCRDVLKLKKGQRVVISNGRII
GPLEDNELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKG
EARIEYQFFEDKHSAIKLKPKEGETYYDVVAVVDPVTREAQRLAPLLLVLTQLINMNLRV
FMNCQSKLSDMPLKSFYRYVLEPEISFTADSSFAKGPIAKFLDMPQSPLFTLNLNTPESW
MVESVRTPYDLDNIYLEEVDSIVAAEYELEYLLLEGHCYDITTGQPPRGLQFTLGTSANP
TIVDTIVMANLGYFQLKANPGAWILRLRKGRSDDIYRIYSHDGTDSPPDANDVVVILNNF
KSKIIKVKVQKKADMANEDLLSDGTNENESGFWDSFKWGFSGQKAEEVKQDKDDIINIFS
VASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMAKKYNFQYELVQYK
WPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPY
GYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQG
LSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKE
PKLEAAVRIVPEWQDYDQEIKQLQTLFQEEKELGTLHTEETQEGSQKHEEL
NT seq 4656 nt   +upstreamnt  +downstreamnt
atgtgcagccggggggatgcgaacactgcggatgccgcggctgcgcggcgggtgacaggg
ctccgttacaacatgagactcctgattgcactggccttaccgtgcctgttttccttagca
gaagccaattcaaaagccattaccacctctctcaccacaaagtggttttctgccccactg
ctgctggaagccagtgagttcttagcagaagacagtcaagagaaattttggagttttgta
gaagccactcaaaacattggatcatcagatcatcacgatactgatcactcctattacgat
gccgtattggaagctgcgtttcgcttcctgtcccctctgcagcagaatttgttgaagttt
tgtctctctctccgttcctactcagcctcaattcaagccttccagcagatagcagttgac
gagcctccaccagaagggtgcaagtcgtttctctcagtgcatggaaagcagacttgtgat
ctagacactctggagagccttctgctgactgccgctgacagaccgaaaccattattgttc
aaaggagatcacagatatccctcatcaaatcctgagagtccagtggtcatcctttattct
gagattggccatgaagaattttctaatattcaccaccaacttatatcaaaaagcaacgaa
ggcaaaattaattatgtattccgacattatatatctaatcccagcaaggagccggtttac
ctttctggctatggagtggaactggcgatcaagagcacggagtacaaggccaaggatgat
actcaggtgaaaggaactgaggtaaatgccacggtcatcggggagagcgaccctattgat
gaagtgcagggattcctctttggaaaattaagagaactgtaccccgccttggaaggacag
ctgaaagagttccggaagcaccttgtggagagcaccaacgagatggcccccctgaaagtc
tggcagctgcaagatctcagcttccagactgctgcccgaatcttggctgcttctggggca
ttatctctggtggtgatgaaggacattagtcagaactttcctaccaaggccagagcaata
acgaaaacggctgtgagcgcgcagcttagagcggaagtggaagagaaccagaagtatttc
aagggaactataggattacagcctggagactcagcgctcttcatcaatggacttcatatc
gatttagacacccaggatatattcagtctatttgatacattgaggaatgaagcccgtgta
atggagggtctgcacaggctgggaatagaaggcctttctctacataatattttgaagctg
aacatccagccctctgagactgactacgcagtagacatcaggagtcctgctatttcctgg
gtcaacaacctagaggtcgatagccgatataactcatggccttcaagcttacaggagtta
ctccgccccacgtttcctggtgtcatacggcagatcagaaagaacctgcataacatggtt
ttcattatcgatcctgtacacgagaccacagccgagttgattagcatcgccgagatgttc
ctcagcaatcacataccgctaaggattggttttatctttgtggtcaatgactctgaagat
gttgatgggatgcaagatgctggagtcgctgttctgagagcgtataattatgtggctcag
gaagtggatggctatcacgccttccagactctcacacagatctataacaaggtgaggact
ggagagacagtgaaagtggagcacgtggtcagtgtcttggagaagaagtacccgtacgtg
gaagtgaatagcattctgggaattgattctgcttacgatcagaatcggaaggaagcaaga
ggctactatgagcagactggagtaggccccctgcctgttgtcctgttcaatggaatgccc
tttgaaaaggagcagttagacccggatgagctggaaaccatcacaatgcacaagatcttg
gagacaaccaccttcttccaaagagctgtgtacttgggtgagctgtcccatgatcaagat
gtggtagagtacatcatgaatcagccaaatgttgttccaagaatcaactctaggattctg
acagctaagcgagagtatctggacctaacagcaagcaataatttttatgtggatgacttt
gccagattttctgccttggactctcggggcaagacggctgctattgccaacagtatgaac
tatctgacgaaaaaaggaatgtcctccaaggaaatctatgatgattcttttattagacca
gtgactttttggattgttggagattttgatagcccttctgggcggcagctactatatgat
gccattaaacatcagaaaaccagtaacaatgttaggataagtatgatcaacaatcccagc
caagagatcagtgactcaagcacccccatcttcagagccatctgggcagctctgcaaaca
caggcctccagctctgctaagaacttcatcaccaagatggccaaagaggagacggcagag
gccctggccgcaggagtggacattgcggaattctctgtcgggggcatggatgtcagtctt
tttaaagaggtctttgagtcttccagaatggatttcattttgtctcatgccctgtactgc
agggatgttctgaagctgaagaagggacagcgagtggtgatcagcaacggaaggatcatt
gggcctctggaggacaatgagctcttcaaccaagatgatttccacctcctggaaaatatc
atcctgaaaacatcgggacagaaaataaagtctcatatccaacagcttcgagtagaagaa
gacgtggccagtgatttggtaatgaaggtggatgctctcctgtcagcacaacccaaagga
gaggcgaggatcgagtaccagttctttgaggataaacacagtgcaattaagctgaagccc
aaagaaggagagacatactatgatgtggtagccgttgttgaccctgtcacacgagaagca
cagaggctcgcccccttgctcttggttttgactcagctgataaacatgaatctaagagta
tttatgaattgccaatccaagctttccgacatgcctttaaaaagcttttaccgttacgtc
ttagagccggagatttctttcactgcagacagcagctttgctaagggaccgatagcaaag
tttctggatatgccacagtctccgctgtttactttgaatctgaacacacctgagagttgg
atggtagaatctgtcagaacaccatatgatctggataatatttatctagaagaggtggac
agtatagtggctgctgagtatgagctggaatatctgttactagaaggtcattgttacgac
atcaccacaggccagccccctcgaggactacagttcactttaggaacttcagccaaccca
acaattgtggacacaattgtgatggccaatctgggatattttcagctcaaagccaatccg
ggagcctggattctgagactgaggaaggggcgctcagatgacatttataggatctacagc
catgatggtacagattcccctcctgatgcaaacgacgttgttgtcatcctcaataacttc
aagagcaagatcatcaaagtgaaggttcagaagaaggcagacatggctaatgaagacttg
ctgagtgatgggacaaatgagaacgagtctggattctgggactcattcaagtggggcttc
tcaggacagaaggctgaagaagtgaagcaagataaagatgacataatcaatattttctct
gttgcatctggtcatctctacgaaagatttcttcgcatcatgatgctctcagtcctgaag
aataccaagactcctgtgaagttctggttcttgaagaactacttgtcccccacatttaag
gagtttataccttacatggccaaaaaatacaatttccagtatgagcttgttcagtacaaa
tggccaaggtggcttcaccagcagacggagaagcagcgaatcatctggggctacaagatc
ctcttcctggacgtgcttttcccgctggttgttgacaagttcctctttgtggatgctgat
cagattgtacggacagatctgaaggagttaagagatttcaatttggatggtgcgccttac
ggttacactcccttctgcgacagcaggagagagatggatggctaccgcttctggaagtca
gggtactgggccagtcatttggctggacgaaagtatcacatcagtgcgctgtatgtcgtg
gatctgaagaagtttaggaaaatagctgctggagacagactcaggggacagtaccaaggt
ctgagccaggatcccaacagtctttcaaatcttgatcaagatttgcccaataacatgatc
catcaggtgccaatcaaatcgctccctcaggaatggctttggtgtgaaacgtggtgtgat
gacgcctctaagaagcgggcaaagaccatcgacctgtgtaataatcccatgactaaggag
cccaaactggaggctgccgtgcggatcgtccctgagtggcaagactacgaccaggagatc
aagcagctgcagaccctcttccaagaggagaaggagctggggaccctgcatacagaggag
acgcaggaaggctctcagaagcatgaggaattatga

DBGET integrated database retrieval system