KEGG   Mus musculus (mouse): 320024Help
Entry
320024            CDS       T01002                                 

Gene name
Nceh1, Aadacl1, B230106I24Rik, CPO-BP, Nceh
Definition
(RefSeq) neutral cholesterol ester hydrolase 1
  KO
K14349  neutral cholesterol ester hydrolase 1 [EC:3.1.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
mmu04976  Bile secretion
mmu04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    320024 (Nceh1)
  09154 Digestive system
   04976 Bile secretion
    320024 (Nceh1)
   04979 Cholesterol metabolism
    320024 (Nceh1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    320024 (Nceh1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    320024 (Nceh1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     320024 (Nceh1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   320024 (Nceh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Say1_Mug180 AXE1 Esterase_phd Chlorophyllase2
Motif
Other DBs
NCBI-GeneID: 320024
NCBI-ProteinID: NP_848887
MGI: 2443191
Ensembl: ENSMUSG00000027698
Vega: OTTMUSG00000028153
UniProt: Q8BLF1
Position
3; 3 A3
AA seq 408 aa AA seqDB search
MRSSCVLLAALLALAAYYVYIPLPSAVSDPWKLMLLDATFRGAQQVSNLIHSLGLNHHLI
ALNFIITSFGKQSARSSPKVKVTDTDFDGVEVRVFEGSPKPEEPLRRSVIYIHGGGWALA
SAKISYYDQLCTTMAEELNAVIVSIEYRLVPQVYFPEQIHDVIRATKYFLQPEVLDKYKV
DPGRVGISGDSAGGNLAAALGQQFTYVASLKNKLKLQALVYPVLQALDFNTPSYQQSMNT
PILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTSLDVERAAALRARLDWTSLLPSSIKKNY
KPIMQTTGNARIVQEIPQLLDAAASPLIAEQEVLEALPKTYILTCEHDVLRDDGIMYAKR
LESAGVNVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgtcatgcgtcctactggccgctctgctggctctggctgcctactacgtgtac
atcccactgcccagcgcggtgtccgacccctggaaactgatgctgctggacgccactttc
cgcggcgcgcagcaagtgagtaacctgatacattccctgggactgaaccaccatctgatc
gcgctgaatttcatcatcacctcttttggcaagcaaagcgcaaggtcttctccgaaagtg
aaggtgacagacaccgacttcgatggggtagaagtccgagtatttgaaggttctccgaaa
ccagaagagccgctgcgacgcagcgtcatctatatccacggaggaggctgggccctggct
agtgcaaagatcagctactatgaccagctgtgcacaacaatggctgaggagctgaacgcc
gtcatcgtttctattgaatacaggctagtcccacaggtctattttccggagcaaatccat
gatgtcatccgtgccactaaatatttcctgcagccagaagtcttagacaagtacaaggtc
gaccctggaagagtcggtatttctggagacagtgctggtgggaatctggccgcggccctg
ggacaacagtttacctacgttgccagcctgaagaataagctcaaactgcaggctttggtc
tacccagtcctgcaggctttggacttcaacacaccctcttaccagcaaagcatgaacact
ccgatcctgccgcgtcatgtcatggttaggtactggttagactacttcaagggcaactac
gactttgtagaggccatgattgtgaacaatcacacttcacttgatgtagaaagggctgca
gccctcagggcccgtctcgactggacatccctgttgccctcgtccatcaaaaagaactac
aagcctatcatgcagaccacagggaacgccaggatcgtccaggagatccctcaactgctg
gacgctgctgcttctccgctcatcgcagagcaggaagtgctagaggccctcccgaagacc
tacatccttacctgcgagcacgacgtcctgcgggacgatgggatcatgtacgccaagcgc
ttggagagtgcgggtgtgaacgtgaccttggaccactttgaggacggcttccatggttgt
atgatttttacaagctggccgaccaacttctccgtgggaatccggactaggaatagttac
atcaaatggctggatcaaaacctgtga

DBGET integrated database retrieval system