KEGG   Mus musculus (house mouse): 320040
Entry
320040            CDS       T01002                                 
Symbol
Rnf222, 9930039A11Rik
Name
(RefSeq) ring finger protein 222
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-RING_UBOX zf-RING_2 zf-RING_5 zf-C3HC4 zf-C3HC4_3 zf-C3HC4_2 FYVE Prok-RING_4 zf-RING_11 FYVE_2 zf-4CXXC_R1 zf-C3HC4_4 zf-RING_4 zf-rbx1 zf-Nse zf-ANAPC11 DUF2225
Other DBs
NCBI-GeneID: 320040
NCBI-ProteinID: NP_796034
MGI: 2443227
Ensembl: ENSMUSG00000046490
UniProt: Q8CEF8
Position
11:68772947..68786605
AA seq 211 aa
MSEGGSKDSSGSECPVCYEKFRDLDGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTIV
CPICRYVTFLSKKSSRWPSMLDKSSQTLTVPVGLPSTPSPDRGGHTNPLVISHQVWRQSS
SQGSQVPLDLLPSLPRESQIFIISRHGMPLGEQDSVLPRRSLAEISEASPAPSATRSFCC
RSRALLLITLIAVVAVVAAILPWVLLVRKQA
NT seq 636 nt   +upstreamnt  +downstreamnt
atgtcagaaggaggaagcaaggacagctcgggcagcgagtgccctgtgtgctatgagaag
ttccgggatctggacggcgccagcaggacgctgagctgcggccatgtgttctgccatgac
tgcttggtcaagtacctgctctctacccgagtggatggacaggtgcagaggactatcgtc
tgccccatctgccgctatgtcaccttcctcagcaagaagagctcccgctggccctccatg
ctggacaagagctcgcagaccctgactgtgcctgtgggcctgccctccacgccctcacca
gaccgcggaggccacacaaaccccctggttatttcccaccaggtctggagacaatcatca
agccaagggtctcaggtccccttggacctgctgcccagcctgcctcgagaatcacagatt
ttcatcatcagtcgccacgggatgccgctgggggaacaggacagcgtgctgccccgacgc
agcctggcagagatttcagaggcatccccggctcccagcgccacccgctctttctgctgc
cggtctcgtgccctcctgctcatcaccctcattgccgtggtggctgtggtagctgccatc
ctgccctgggtgctgctggtgaggaagcaggcctga

DBGET integrated database retrieval system