KEGG   Mus musculus (mouse): 320078
Entry
320078            CDS       T01002                                 

Gene name
Olfml2b, 1110018N05Rik, 4832415H08Rik, AI467542
Definition
(RefSeq) olfactomedin-like 2B
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: OLF Noelin-1 HMMR_C
Other DBs
NCBI-GeneID: 320078
NCBI-ProteinID: NP_796042
MGI: 2443310
Ensembl: ENSMUSG00000038463
Vega: OTTMUSG00000026879
UniProt: Q3V1G4 Q8BY24
Position
1; 1 H3
AA seq 746 aa
MAYPLPLVLCFALVVAQVWGSTTPPTGTSEPPDVQTVEPTEDDILQNEADNQENVLSQLL
GDYDKVKAVSEGSDCQCKCVVRPLGRDACQRINQGASRKEDFYTVETITSGSSCKCACVA
PPSAVNPCEGDFRLQKLREADSRDLKLSTIIDLLEGAFYGLDLLKLHSVTTKLVGRVDKL
EEEVSKNLTKENEQIKEDVEEIRTELNKRGKENCSDNTLESMPDIRSALQRDAAAAYAHP
EYEERFLQEETVSQQINSIELLRTQPLVPPAAMKPQRPLQRQVHLRGRLASKPTVIRGIT
YYKAKVSEEENDIEEQHDELFSGDSGVDLLIEDQLLRQEDLLTSATRRPATTRHTAAVTT
DASIQAAASSSEPAQASASASSFVEPAPQASDRELLATPQTTTVFPEPTEVMPSTQVSPT
TVAHTAVQPLPAMVPGDIFVEALPLVPLLPDTVGTDMPEEEGTAGQEATSAGPILSPEEE
DDIRNVIGRCKDTLSTITGPTTQNTYGRNEGAWMKDPLAKDDRIYVTNYYYGNTLVEFRN
LENFKQGRWSNSYKLPYSWIGTGHVVYNGAFYYNRAFTRNIIKYDLKQRYVAAWAMLHDV
AYEEATPWRWQGHSDVDFAVDENGLWLIYPALDDEGFNQEVIVLSKLNAVDLSTQKETTW
RTGLRRNFYGNCFVICGVLYAVDSYNQRNANISYAFDTHTNTQIVPRLLFENEYSYTTQI
DYNPKDRLLYAWDNGHQVTYHVIFAY
NT seq 2241 nt   +upstreamnt  +downstreamnt
atggcctatcccctgccattggttctctgctttgctctggtggtggcacaggtctggggg
tccactacacctcccacagggacaagcgagccccctgatgtgcaaacagtggagcccacg
gaagatgacattctgcaaaacgaggcggacaaccaggagaacgttttatctcagctgctg
ggagactatgacaaggtcaaggctgtgtctgagggctctgactgtcagtgcaagtgtgtg
gtgagaccgctgggccgagatgcctgccagaggatcaaccagggggcttccaggaaggaa
gacttctacactgtggaaaccatcacctcgggctcatcctgtaaatgtgcttgtgttgct
cctccgtctgccgtcaatccctgtgagggagacttcaggctccagaagcttcgggaggct
gacagccgagatttgaagctgtctacaattatagacctgttggaaggtgctttctacggc
ctggacctcctaaagctgcattcggttaccactaaactcgtggggcgagtggataaactg
gaggaggaagtctctaagaacctcaccaaggagaatgagcaaatcaaagaggatgtggaa
gaaatccgaacggagctgaacaagcgaggcaaggagaactgctctgacaacaccctagag
agcatgccagacatccgctcagccctgcagagggatgcggctgcagcctatgcccaccca
gagtatgaagaacggtttctgcaggaggaaactgtgtcacagcagatcaactccatcgaa
ctcctgaggacgcagccactggtccctcctgcagcgatgaagccgcagcggcccctgcag
agacaggtgcacctgagaggtcggctggcctccaagcccaccgtcatcaggggaatcacc
tactataaagccaaggtctctgaggaggaaaatgacatagaagagcagcacgatgagctt
ttcagtggcgacagtggagtggacttgctgatagaagatcagcttctaagacaggaagac
ctactgacaagtgccacccggaggccagcaaccactcgtcacactgctgctgtcacgact
gatgcgagcattcaggccgcagcctcatcctcagagcctgcacaggcctctgcctcagca
tccagctttgttgagcctgctcctcaggcctccgatagagagctcttggcaaccccacag
actaccacagtgtttccagagcccacggaggtgatgccttctacccaagtctcacccacc
accgtggcccacacagctgtccagccacttccagcaatggttcctggggacatatttgtg
gaagctctacccttggtccctctgttacctgacacagttgggacagacatgccagaggaa
gaggggactgcagggcaggaagcaacctctgctggtcccatcctgagccctgaagaagaa
gatgacattcggaatgtgataggaaggtgcaaggacaccctctctacaatcacaggaccg
accacccagaacacatatggacggaatgaaggggcctggatgaaggaccccctagccaag
gacgaccgcatttacgtaaccaactattactatggcaacacactggttgagttccgaaac
ctggagaacttcaaacaaggtcgctggagcaattcctacaagcttccatacagctggatt
ggcacgggtcacgtggtctacaacggcgccttctactataaccgggccttcacccgaaac
atcatcaagtatgacctgaagcagcgttatgtggctgcctgggccatgctgcacgatgtg
gcctatgaggaggccactccttggcggtggcagggtcactcggatgtggactttgctgtg
gatgagaatggcctgtggcttatctacccagctctggatgatgaaggtttcaaccaggag
gtcattgtcctgagcaagctcaatgccgtggacctgagcacgcagaaggagaccacgtgg
cgcactgggctccggaggaatttctatggcaactgctttgtcatctgtggggtactatat
gctgtggacagctataaccagaggaatgccaacatctcctatgcctttgacacacacacc
aacacacagattgtccctaggctgctgtttgagaatgaatattcgtacaccacccagata
gactacaaccccaaggaccgcctcctctatgcctgggacaatggccaccaggtcacctac
catgtcatctttgcctactga

DBGET integrated database retrieval system