KEGG   Mus musculus (mouse): 320116Help
Entry
320116            CDS       T01002                                 

Gene name
Fndc9, C030019I05Rik
Definition
(RefSeq) fibronectin type III domain containing 9
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 320116
NCBI-ProteinID: NP_796049
MGI: 2443410
Ensembl: ENSMUSG00000048721
Vega: OTTMUSG00000007517
UniProt: Q8BJN4
Position
11; 11 B1.1
AA seq 226 aa AA seqDB search
MNIEVGNVSHTGAIISWSPSEPCLEDYYHIMYRPNWNSIFSGYLRYNFHHEEKVPRTITS
VALEHLAPSTLYFLCISCKKAAFPYSHYCTMFHTLDKSPLAAGGSLVDPQISLWVLMAIL
LACFTAVLAFICLQFWCLRCHEPRWSYRAGQMEEANGLVRWPEETPALGQREEDLQGFPL
EELPRKNSGARAKAEPEAEAIQDALEVVALAREIGNQPAILPHYRE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacattgaggttgggaacgtgtctcacacaggagccatcatctcctggtcaccctcg
gagccctgcttggaggactattaccatattatgtacaggcccaactggaacagtatcttc
tccggatacctgcgctataacttccatcacgaggagaaggtgcctcgaaccatcacctct
gtggcattggaacacctcgctccttccactctctacttcctctgtatcagctgcaagaag
gctgccttcccgtatagtcactactgtaccatgttccacaccctggataagagtccgctg
gctgccgggggctccctggtggacccccagatttctctttgggtgctgatggccatcctg
ctggcctgcttcactgctgtgctggccttcatctgcctccagttctggtgcctccgctgt
cacgaacctcggtggtcttacagagccggccaaatggaggaagccaatgggttggtaaga
tggcccgaggagaccccagctcttggtcagagggaagaagacctgcaggggttccccctg
gaggaactgccacgaaagaactcaggggccagggccaaagctgaaccagaggctgaagcc
atccaggatgccttagaggtggtggccttagctagagagattggtaaccaaccggccata
ctgcctcactatagggagtga

DBGET integrated database retrieval system