KEGG   Mus musculus (mouse): 320129
Entry
320129            CDS       T01002                                 

Symbol
Grk3, 4833444A01Rik, AI851927, AW551196, Adrbk-2, Adrbk2, Bark-2
Name
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04144  Endocytosis
mmu04340  Hedgehog signaling pathway
mmu04724  Glutamatergic synapse
mmu04740  Olfactory transduction
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    320129 (Grk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    320129 (Grk3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    320129 (Grk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    320129 (Grk3)
  09157 Sensory system
   04740 Olfactory transduction
    320129 (Grk3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    320129 (Grk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    320129 (Grk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    320129 (Grk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     320129 (Grk3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   320129 (Grk3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   320129 (Grk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal CTD9
Other DBs
NCBI-GeneID: 320129
NCBI-ProteinID: NP_796052
MGI: 87941
Ensembl: ENSMUSG00000042249
Vega: OTTMUSG00000054354
UniProt: Q3UYH7 Q8BVT9
Position
5:complement(113058344..113163518)
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKTAPAARASKKVVLPEPSIRSVMQRYLAERNEITFDKIFN
QKIGFLLFKDFCLNEIGEAVPQVKFYEEIKEYEKLDNEEDRLRRSRQMYDAYIMRELLSS
THQFSKQAVEHVQSHLSKKQVTATLFQPYIEEICESLRGDIFQKFMESDKFTRFCQWKNV
ELNIHLSMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRVKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDMHYHLSQHGVFSEKEMRFYASE
IILGLEHMHTCFVVYRDLKPANILLDEYGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTCYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVQLPDAFSPE
LRSLLEGLLQRDVSQRLGCGGGGARELKEHIFFKGIDWQHVYLRKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLVISERWQQEVVETIYDAVNADTDKIEARR
KAKNKQLGQEEDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQSL
LTMEQIMSVEETQIKDRKCILLRIKGGKQFVLQCESDPEFAQWLKELTCTFNEAQRLLRR
APKFLNKPRAAILEFSKPPLCHRNSSGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgacgtcagctacctgatggccatggagaagagc
aagacggcgccggccgcgcgcgccagcaagaaggtcgtcctgccggagcccagtatccgg
agtgtgatgcagaggtatctggcagagagaaacgaaataacctttgacaagattttcaat
cagaaaatcggcttcctactatttaaagacttctgcttgaatgaaattggggaagcagtg
cctcaggtgaaattttatgaagagataaaagaatatgagaagctggacaacgaagaggat
aggctacgccggagccggcagatgtacgacgcctacatcatgagggagctcctatccagc
acacaccaattctcaaagcaagctgtagaacatgtccagagccatctctccaagaaacag
gtgacggctacacttttccagccatacatagaagaaatctgtgaaagccttcgtggggat
attttccaaaagtttatggaaagcgataaattcactagattctgtcagtggaagaacgtg
gagttgaatattcacctgagcatgaacgacttcagtgtgcacaggatcatcggccgagga
gggtttggggaagtttatggctgcaggaaagcagacaccggtaaaatgtatgccatgaag
tgcttagacaagaaaagggtgaagatgaagcagggggagactctggctttgaacgagagg
atcatgctgtctctcgttagcactggggattgtccctttattgtctgcatgacctacgcc
ttccacacgccggacaaactctgcttcatcctggacctgatgaacgggggcgacatgcac
taccatctctctcaacacggggtgttttctgagaaggagatgcggttttatgccagcgag
atcatcctgggcctcgagcacatgcacacctgcttcgtagtctacagagacctgaagcct
gcgaacatcctcctagatgaatatgggcacgtgaggatatcggatctcggccttgcctgc
gatttctccaaaaagaagcctcatgccagcgtgggcacccatgggtacatggctcccgag
gtgttgcagaagggaacgtgctatgacagcagcgccgactggttctccctgggctgtatg
ctcttcaagcttctgcggggccacagccccttcaggcagcataaaaccaaagacaagcat
gagatagaccgaatgaccctgaccgtgaacgtgcagcttccagatgccttctcccctgag
ctgaggtccctcttagagggtttgctccagcgggacgtgagccagcggctgggctgcgga
ggaggaggggcacgagagttgaaggagcacatcttcttcaagggcattgactggcagcat
gtgtacttacggaagtacccgccacccctaatccctcctcggggagaggtcaacgctgca
gatgccttcgatatcggctccttcgatgaggaagacaccaaaggcattaagctgttggac
tgtgaccaggacctctataagaacttcccactggtgatctccgagcgctggcagcaagaa
gtggtggagaccatctatgacgccgtcaatgctgatactgataaaatcgaggccaggagg
aaggctaaaaataagcaacttggtcaagaggaagattacgctatggggaaggactgcatc
atgcacgggtacatgctgaagctggggaacccctttctcacacagtggcaaagacgctat
ttttacctgttccccaacagactggagtggagaggagagggcgagtctcggcaaagtcta
ctgaccatggaacagatcatgtctgtggaggagacccagattaaagacagaaagtgcatc
ttactcaggataaagggagggaagcaatttgtcttgcaatgtgagagtgaccccgagttt
gcacagtggctgaaggagctgacctgcaccttcaatgaggcccagagactgctgcgccgt
gcccccaaattcctcaacaaaccacgggccgccatcctggagttctccaagccaccactg
tgtcacagaaatagcagcggcctctga

DBGET integrated database retrieval system