KEGG   Mus musculus (mouse): 320145Help
Entry
320145            CDS       T01002                                 

Gene name
Sp8, D930049B17Rik, mBtd
Definition
(RefSeq) trans-acting transcription factor 8
  KO
K09198  transcription factor Sp8
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    320145 (Sp8)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 ubiquitous factors
    320145 (Sp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-Di19 zf-C2H2_jaz zf-met zf-C2H2_8 Zn-C2H2_12 zf-C2H2_6 zf-H2C2_5 DUF2225
Motif
Other DBs
NCBI-GeneID: 320145
NCBI-ProteinID: NP_796056
MGI: 2443471
Ensembl: ENSMUSG00000048562
UniProt: Q8BMJ8 Q5QR90
Position
12; 12 F2
AA seq 486 aa AA seqDB search
MLAATCNKIGSPSPSPSSLSDSSSSFGKGFHPWKRSSSSSSGSCNVVGSSLSSFGVSGAS
RNGGSSSAAAAAAAAAAAAAALVSDSFSCGGSPGSSAFSLTSSSAAAAAAAAAAAASSSP
FANDYSVFQAPGVSGGSGGGGGGGGGGSGAHSQDSSHQPVFISKVHTSVDGLQGIYPRVG
MAHPYESWFKPSHPGLGAAADVGSAGASSWWDVGAGWIDVQNPNGAAALPGSLHPAAGGL
QTSLHSPLGGYNSDYSGLSHSAFSSGASSHLLSPAGQHLMDGFKPVLPGSYPDSAPSPLA
GAGSSMLSAGPAAQLGGSPRSSARRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCHI
PGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPV
CNKRFMRSDHLSKHVKTHSGGGGSAGSGGGKKGSDTDSEHSAAGSPPCHSPELLQPPEPG
HRNGLE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgctacctgtaataagatcggcagccccagcccgtctccctcctccctgtcg
gacagctcttcttccttcggtaaaggcttccacccttggaaacgctcctcgtcttcctcc
tccggcagctgcaacgtagtgggttccagtctctctagcttcggtgtgtcgggggcctcc
cggaacggcggctcctcctcagccgcagcggcggcagcggcggcagcagcggcggccgca
gccctggtgtccgactcttttagctgcggaggctcgcccggctccagcgccttctctctc
acctccagcagcgccgccgcagcggcagcagctgcggcggctgccgcttccagctcgccc
tttgccaacgactactctgtgttccaggctccgggcgtctcggggggcagcggcggcggc
ggcgggggaggcggcggcggttccggagcgcactcgcaggatagctcccatcagccagtg
tttatctccaaggtgcacacgtcggtggacggactgcagggtatctacccgcgcgtggga
atggcgcacccgtatgagtcctggttcaagccttcgcacccgggccttggcgccgcggcc
gacgtgggctccgcgggcgcctccagctggtgggatgtgggcgcgggctggatcgacgtg
cagaaccccaatggggcggcagcgctgcccggctcgctgcacccggcggccgggggcctt
cagacgtcgctgcattcaccgctgggaggctacaactcggattattccggcctgagccac
tccgcattcagtagcggtgcctcgtcgcacctgctcagccctgcaggacagcacctcatg
gacggtttcaagccggtattgcccggctcttaccccgattccgccccgtcgccgctggcc
ggcgcgggcagctccatgctgagcgcggggcccgcggcgcagttaggggggtccccacgc
tcgtccgctcgccgctactccggccgcgccacttgcgactgccccaactgccaggaggct
gagcggctgggcccagcgggagcgagcctgcgtcgcaaagggctgcatagctgccacatc
ccgggctgcggcaaggtgtacggcaagacgtcgcacctgaaggcgcacctgcgttggcac
accggcgagcggccgttcgtgtgcaattggctgttctgcggtaagcgctttacgcgctcc
gacgagctgcagcggcacctgcggacccacacgggcgagaagcgcttcgcctgcccggtg
tgcaacaaacgcttcatgcgcagcgaccacctgagcaagcacgtgaagacacacagtggt
ggcggcggctcggcgggctccggcggcggcaagaaaggcagcgacaccgacagcgagcac
agcgcggcgggaagccctccttgccactcccctgagctgttgcagcctccagagccgggc
caccgcaacggcctggagtga

DBGET integrated database retrieval system