KEGG   Mus musculus (house mouse): 320150
Entry
320150            CDS       T01002                                 
Symbol
Zdhhc17, A230053P19Rik, D130071N24Rik, DHHC-17, Hip14
Name
(RefSeq) zinc finger, DHHC domain containing 17
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    320150 (Zdhhc17)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     320150 (Zdhhc17)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    320150 (Zdhhc17)
SSDB
Motif
Pfam: DHHC Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 320150
NCBI-ProteinID: NP_766142
MGI: 2445110
Ensembl: ENSMUSG00000035798
UniProt: Q80TN5 Q8BIT5
Position
10:complement(110777640..110848587)
AA seq 632 aa
MQREEGFNTKMADGPDEYETETGCVPLLHPEEIKPQSHYNHGYGEPLGRKTHIDDYSTWD
IVKATQYGIYERCRELVEAGYDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLG
GDLNSTPLHWATRQGHLSMVVQLMKYGADPSLIDGEGCSCIHLAAQFGHTSIVAYLIAKG
QDVDMMDQNGMTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTV
ISLLLEAGGNVDAQNVKGESALDLAKQRKNVWMINHLQEARQAKGYDNPSFLRKLKADKE
FRQKVMLGTPFLVIWLVGFIADLDIDSWLIKGLMYGGVWATVQFLSKSFFDHSMHSALPL
GIYLATKFWMYVTWFFWFWNDLNFLFIHLPFLANSVALFYNFGKSWKSDPGIIKATEEQK
KKTIVELAETGSLDLSIFCSTCLIRKPVRSKHCGVCNRCIAKFDHHCPWVGNCVGAGNHR
YFMGYLFFLLFMICWMIYGCVSYWGLHCETTYTKDGFWTYITQIATCSPWMFWMFLNSVF
HFLWVAVLLMCQLYQITCLGITTNERMNARRYKHFKVTTTSIESPFNHGCVRNIIDFFEF
RCCGLFRPVIVDWTRQYTIEYDQISGSGYQLV
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgcagcgggaggagggatttaacaccaagatggcggacggcccggatgagtacgagacc
gaaacgggctgcgtgccccttctccacccggaggaaatcaaaccacagagccactataac
catggctatggagaacctcttggtcggaaaactcatattgatgactatagcacatgggac
atcgtcaaggcgacacaatatggaatatatgaacgctgccgagaattggtggaagcgggt
tacgatgtacggcaaccagacaaagaaaatgttacacttcttcattgggctgccatcaat
aacagaatagatttagtcaaatactatatttcgaaaggtgctattgtggatcaacttgga
ggagacctgaattcaactccgttgcactgggccacaagacaaggccatttatccatggtt
gtacaactaatgaaatatggtgcagacccctccttaattgatggggaaggatgcagctgt
atccacttggctgctcagttcggacatacctcaattgttgcttatcttatagcaaaagga
caggatgtagatatgatggatcagaatggaatgacccctttaatgtgggcagcttataga
acacatagtgtggatccaactagattgcttttaacattcaatgtttcagttaaccttggt
gacaagtatcacaaaaacactgctctgcactgggcagtcctagcagggaacaccacagtc
attagtcttcttctggaagccggaggcaatgtggacgcccagaacgtcaagggtgagtca
gcacttgatttggcaaagcaaagaaaaaacgtgtggatgatcaaccatttgcaggaggca
aggcaagcgaaagggtatgacaacccatccttcctcagaaagctgaaggctgacaaggaa
tttcggcagaaagtaatgctgggaaccccattcctggtgatctggctggtcgggtttata
gcagacctagacattgattcttggctcattaaagggttaatgtatggtggcgtttgggct
acagtgcaatttctttccaagtccttctttgaccattcaatgcacagcgcattgcccctt
gggatatatttggcaaccaaattctggatgtatgtgacatggttcttctggttctggaat
gatctcaacttcctgttcatccacctccccttccttgccaacagcgttgctcttttctac
aattttggaaagtcttggaaatcagatccagggattattaaagctacagaagaacaaaag
aaaaagacgatagttgaacttgcagagactggaagtctggacctcagtatattctgcagt
acctgcttgattcggaagccagtgaggtccaaacactgtggtgtgtgcaaccgctgtata
gcgaaatttgatcaccattgcccatgggtgggtaactgtgtaggtgcaggcaaccatagg
tactttatggggtacctgttcttcttgcttttcatgatctgctggatgatctatggttgt
gtctcttactggggccttcactgtgagaccacgtacaccaaggatgggttttggacatac
ataactcagatcgccacatgctccccgtggatgttctggatgtttctcaacagtgtgttt
cacttcctgtgggtggccgtgctgctcatgtgtcagctgtaccagataacatgtttaggt
attactacaaatgaaagaatgaacgccaggagatacaagcactttaaagttacgacaaca
tctattgaaagcccattcaaccatggatgtgtaaggaatattatagacttctttgaattt
cgatgctgtggcctctttcgtcctgttatcgtggactggaccaggcagtacactatagaa
tatgaccaaatatcaggatctgggtaccagcttgtgtag

DBGET integrated database retrieval system