KEGG   Mus musculus (house mouse): 320158
Entry
320158            CDS       T01002                                 
Symbol
Zmat4, 9630048M01Rik
Name
(RefSeq) zinc finger, matrin type 4
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 zf-U1 TUTase SF3a60_Prp9_C zf-C2H2_6 zf-DBF
Other DBs
NCBI-GeneID: 320158
NCBI-ProteinID: NP_796060
MGI: 2443497
Ensembl: ENSMUSG00000037492
UniProt: Q8BZ94
Position
8:24137347..24553133
AA seq 229 aa
MKSSDIDQDLFTDSYCKVCSAQLISESQRVAHYESRKHASKVRLYYMLHPRDGGCPAKRL
RAENGSDADMVDKNKCCTLCNMSFTSAVVADSHYQGKIHAKRLKLLLGEKPPLKTTAAPL
SSLKAPRVDTAPVVASPYQRRDSDRYCGLCAAWFNNPLMAQQHYEGKKHKKNAARVALLE
QLGTSLDLGELRGLRRTYRCTTCSVSLNSIEQYHAHLQGSKHQTNLKNK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgaagtcctccgatatcgatcaggatttatttacagatagctactgcaaggtgtgcagc
gcacagctgatatccgagtcccagcgggtggcccattatgagagtcgaaaacatgccagc
aaagtccggctgtattacatgcttcaccccagggatggtgggtgtcctgccaagaggctc
cgagcagaaaatggaagcgatgctgacatggtggataagaataaatgctgtacactctgt
aacatgtcctttacctcagctgtggtggccgactcacattaccaaggcaaaatccacgcc
aaaaggttaaaactgttgctaggagagaaacctccactgaaaaccacagccgctccgctg
agctcacttaaggctcctcgagtggatacggcccccgtggtcgcatctccctatcaaaga
agagactcagacaggtactgcggtctctgcgcagcctggtttaacaatcctctgatggcc
cagcagcattacgaaggcaagaaacacaaaaagaacgcagcccgcgttgccttgctagag
cagctcggaacatctctggatctgggagaactgagaggtctgagacgtacttacagatgt
accacgtgcagtgtgtcgctcaactccatagaacagtatcatgcacatctgcaaggatca
aaacatcagaccaacctgaagaataagtag

DBGET integrated database retrieval system