KEGG   Mus musculus (mouse): 320207Help
Entry
320207            CDS       T01002                                 

Gene name
Pik3r5, AV230647, F730038I15Rik, Foap2, p101
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04611  Platelet activation
mmu04725  Cholinergic synapse
mmu04921  Oxytocin signaling pathway
mmu05145  Toxoplasmosis
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    320207 (Pik3r5)
   04072 Phospholipase D signaling pathway
    320207 (Pik3r5)
   04022 cGMP-PKG signaling pathway
    320207 (Pik3r5)
   04151 PI3K-Akt signaling pathway
    320207 (Pik3r5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    320207 (Pik3r5)
   04062 Chemokine signaling pathway
    320207 (Pik3r5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    320207 (Pik3r5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    320207 (Pik3r5)
  09156 Nervous system
   04725 Cholinergic synapse
    320207 (Pik3r5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    320207 (Pik3r5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    320207 (Pik3r5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    320207 (Pik3r5)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    320207 (Pik3r5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_1B_p101 DUF2284
Motif
Other DBs
NCBI-GeneID: 320207
NCBI-ProteinID: NP_796294
MGI: 2443588
Ensembl: ENSMUSG00000020901
Vega: OTTMUSG00000005944
UniProt: Q5SW28 A1A4T4
Position
11; 11 B3
AA seq 871 aa AA seqDB search
MQPAATTCTEDRIQHALERCLHGLSLGRRSAPWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTQEVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAASTYHCFLTWPVPYC
SICREMLTFIDAELKAPGISYQRLVRAEQGLPVRSHRSSTVTVLLLNPVEVQAEFLAVAD
KLSTPGQSPHGTYTTLLLHAFQATFGAHCDLPKLHRKLQSKTIEELEDIFTETTEAQELA
SGIGDVAEAREWLRTKLQAVGEKAGFPGILDTASPGKLHTIPIPVARCYTYSWNQDSFDI
LQEVLLKEQELLQPGILGDDEEEEEEDLEMDRHCAERDSLLSTSSLVSHDSTLLLTSSQA
SEPVLSRQMLTTFVSGLSDGMDSGYVEDSEENSEWPQKPGSQKRQGHRRPGQKFNRFYKL
LKSTSQLVLRRDSRSLESSVDPTLPLRRAGSLCSPLDCPAQLPSRAQRSRSLPQAKLTTQ
LPRWLLAPPSHHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRLETSHPI
LTRFFKLQFFYVPVKRSHGTSPSACPSSLSQASPLPADSLKYPSPTDLGMAPWEDSTNDI
SHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKADSRPLEGSATQLPILADMLLYYCRFAA
RPVLLQVYQTELTFVTGEKTTEIFIQSLELGHSATTRAIKASGRGRKRLGIDDDREAVPL
TLQIIYSKGAISGRSRWSNLEKVCTSVNLSKACQKPEELDSSMEALTLTLTEVVKRQNPK
SKKGFNQISTSYIKVDKVQIIGSSSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSSLP
PERSFSQPAETGSDLCSLLCLPIMTFSGALP
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgcagccagcagccacaacgtgcacagaggaccgcatccagcatgctctggagcgatgc
ttgcatggactgagcctcggacgccgttctgctccctggtcagccgggctgtgtctgaac
tgctggagcctacaggagctggtcagcagggacccgggccacttcctcatcctcctggaa
cagatcctacaaaagacccaagaggtccaagagaaaggcacctatgacctcctcgccccg
ctggctctgctcttctattccactgtcctctgtacaccacacttcccaccagactccgac
ctcctgctgaaggcagccagcacctaccactgcttcctgacctggccagttccctactgc
agcatctgcagagagatgctcaccttcattgatgctgaactcaaggccccaggaatctcc
taccagcggctggtgagggctgagcagggcctgcccgtcaggagccaccgaagttccact
gtcactgtgctgttgctgaacccggtagaggtacaggctgaattccttgctgtggcagac
aagctgagcacgcctggacagtcaccccacggcacctacaccaccctgctcctgcatgcc
ttccaggccacctttggggcccactgcgaccttcctaaactacaccgcaaacttcagtcc
aagacaatagaagagctggaggacatcttcaccgagacgacagaagcccaggagctggcg
tctggcattggggatgtagcagaggcccgagagtggctccggaccaagctgcaggcagtg
ggagaaaaagcgggcttccctggcatcttagacactgcaagccctgggaaactccacacc
atccccatccctgtcgccagatgctacacctacagctggaaccaggacagctttgacatc
ctacaggaagtccttctcaaggaacaggagctgctgcagccagggatcttgggagatgat
gaagaggaggaagaggaggacttggagatggacaggcattgcgctgagagggactctctc
ctctccaccagctccctggtgtctcacgactccacactgttgctcacctcctctcaggcc
tcagaaccggtgctgtcccgccagatgctgaccacctttgtctcaggcctctcggatggc
atggacagtggctacgtggaggacagcgaggaaaactcagagtggccccaaaagcccggc
agccagaaacgccagggtcatcgcaggcctgggcagaagttcaacaggttctataaactc
ttaaagagcaccagccagttagtcctgaggagggactctcggagcctggagagcagtgta
gacccaaccctgcctctgcgaagggctgggagcctctgcagccccttggactgtcccgct
cagctcccctcccgggctcagcgctcacggtccttgcctcaggccaagctcaccacccaa
ctccccagatggcttctggcaccaccctcacaccaccagcgccgccgtcccttcctcagt
ggggatgaggaccccaaagcttccacactacgggttgtggtctttggctctgatcggatt
tcagggaaggtggctagggcctatagcaagctcaggaggctggagaccagtcaccctatc
ctcacacgcttcttcaagcttcagttcttctatgtgcctgtgaagagaagccacggaacc
agccccagtgcctgcccatcctctctgagccaagcatctccactccctgcagactccctg
aagtaccccagccctacagaccttggcatggccccatgggaggacagtaccaatgacatc
tctcactacctcggtatgcttgacccctggtacgaacgcaatgtgttgggcctcatgcac
ctgcctcctgaagtcctttgtcagcagtccctgaaggcagactctcggcccctggaggga
tcggccacccagctgcccatcctggccgatatgttactctactactgccgctttgcggcc
cgccccgtgttgctgcaggtttaccagacagagctgacctttgtcaccggggagaagacc
acagagatcttcatccagtctctggagctgggtcactctgcgaccactcgggctatcaag
gcttcaggtcggggtaggaagaggctgggcattgatgacgaccgggaggccgtccctcta
acactacagattatttacagcaagggagccatcagtgggcgaagccgctggagcaacctg
gagaaggtctgcacctctgttaacctcagcaaggcctgccagaagccggaggagctagac
tccagcatggaggcgctaacgctaaccctgacagaagtggtgaagaggcagaaccctaaa
tccaaaaagggctttaaccagatcagtacatcctacatcaaagtggacaaggtgcagatc
atcggctctagcagctgcccctttgccgtgtgtctagaccaggatgagagaaagatcctg
cagagtgtggtcaggtgtgaagtgtcaccctgctacaagccagagaagagcagcttgcca
cccgagaggtccttcagccagccagcagagactgggtccgacctgtgctcccttctctgc
cttcccatcatgacattcagtggggctctgccctag

DBGET integrated database retrieval system