KEGG   Mus musculus (mouse): 320365
Entry
320365            CDS       T01002                                 

Symbol
Fry, 13CDNA73, 9330186A19Rik, AF346502, AI462658, C87180, D930046M03, cg003, mKIAA4143
Name
(RefSeq) FRY microtubule binding protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: MOR2-PAG1_N MOR2-PAG1_C MOR2-PAG1_mid CotJB
Other DBs
NCBI-GeneID: 320365
NCBI-ProteinID: NP_766475
MGI: 2443895
Ensembl: ENSMUSG00000056602
Vega: OTTMUSG00000055493
UniProt: E9Q8I9 Q8BIX6
Position
5 G3; 5 89.36 cM
AA seq 3020 aa
MASQQDSGFFEISIKYLLKSWSNASPVGNGYIKPPVPPASGTHREKGPPAMLPINVDPDS
KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYC
LPSILRTLFDWYKRQNGIEDESHEYRPRTSNKSKSDEQQRDYLMERRDLAIDFIFSLVLI
EVLKQIPLHPVIDSLIHDIINLAFKHFKYKEGYLGPNTGNMHIVADLYAEVIGVLAQAKF
PAVKKKFMAELKELRHKEQSPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHY
FLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLA
LYPLVTCLLCVSQKQLFLNRWHVFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKC
ESNTATQSRLITITTTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLC
VGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMPVTGAVLPSGNTLRVKKTYLSK
TLTEEEAKMIGMSLYYSQVRKAVGNILRHLDKEVGRCMMLTNVQMLNKEPEDMITGERKP
KIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWRE
DVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGRAYEQANKIRNSELIP
NGSSHRMQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFLALGQPEDD
DRPMIDVMDQLSSSILESFIHVAVSDSATLPPTHNVDLQWLVEWNAVLVNSHYDVKSPSH
VWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPVNAK
KTSTASSGDNYVTLWRNYLILCFGVAKPSIMSPGHLRASTPEIMATTPDGTVSYDNKAIG
TPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENK
KRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTRMLLEAEN
DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTP
LDRYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQ
LGCEVVMLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIATVCGNRNYPFDIVTLLN
LVLFKASDTNREIYEVSMQLMQILEAKLFVHSKKVAEQRPGSILYGTHGPLPPLYSVSLA
LLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVDSRLLLPGSS
PSSPEDEVKDREGEVTASHGLKGNGWGSPEATSLVLNNLMYMTAKYGDEVPGAEMENAWN
ALANNEKWSNNLRVTLQFLISLCGVSSDTILLPYIKKVATYLCRNNTIQTMEELLFELQQ
TEPVNPIVQHCDNPPFYRFTASSKASAAASGTTSSSNTVVAGQDSFPDPEESKILKESDD
RFSNVIRAHTRLESRYSNSSGGSYDEDKNDPISPYTGWLLSITEAKQPQPLPMPCSGGCW
APLVDYLPETITPRGPLHRCNIAVIFMTEMVVDHSVREDWALHLPLLLHAVFLGLDHYRP
EVFEHSKKLLLHLLIALSCNSNFHAIASVLLQTREMGEAKTLTMQPAYQPEYLYTGGFDF
LREDQSSPVPDSGLNSSSTSSSISLGGSSGNLPQMTQEVEDVEAATETDEKASKLIEFLT
TRAFGPLWCHEDITPKNQNSKSAEQLSNFLRHVVSVFKDSRSGFHLEQHLSEVALQTALA
SSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVD
NLSDCLKNSDLFTVLSRSSSPDLSSSSKLTASRKSTGQLNVNPGTPGSGGGGGGSGNTTT
AERSRHQRSFSVPKKFGVVDRSSDPPRSATLDRIQACTQQGLSSKTRSNSSLKESLTDPS
HVSHPTNLLATIFWVTVALMESDFEFEYLMALRLLNRLLAHMPLEKAENREKLEKLQAQL
KWADFPGLQQLLLKGFTSLTTTDLTLQLFSLLTSVSKVPMVDSSQAIGFPLNVLCLLPQL
IQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYL
HEAYADITLNMVTYLAELLEKGLPSMQQPLLQVIYSLLSYMDLSVVPVKQFNMEVLKTIE
KYVQSIHWREALNILKLVVSRSASLVLPSYQHSDLSKIELHRVWTSASKELPGKTLDFHF
DISETPIIGRRYDELQNSSGRDGKPRAMAVTRSASSTSSGSNSNVLVPVSWKRPQYSQKR
TKEKLVHVLSLCGQEVGLSKNPSVIFSSCGDLDLPEHQTSLVSSEDGPREQENMDDTNSE
QQFRVFRDFDFLDVELEDGEGESMDNFNWGVRRRSLDSLDKCDMQILEERQLSRSTPSLN
KMSHEDSDESSEEDLTASQILEHSDLIMNLSPSEEANPMELLTSACDSAPADPHSFNTRM
ANFEASLPDINNLQISEGSKAEAVPEEEDTTVHEDDLSSSINELPAAFECSDSFSLDMTE
AEEKGNRGLDQYTLASFGEGDRGVSPPPSPFFSAILAAFQPAACDDAEEAWRSHINQLMC
DSDGSCAVYTFHVFSSLFKNIQKRFCFLTCDAASYLGDNLRGIGSKFVSSSQMLTSCSEC
PTLFVDAETLLSCGLLDKLKFSVLELQEYLDTYNNRKEATLSWLANCKATFAGGSRDGVI
TCQPGDSEEKQLELCQRLYKLHFQLLLLYQSYCKLIGQVHEVSSVPELLNMSRELSDLKR
NLKEATAAIATDPLYIEGAWSEPTFTSTEAAIQSMLECLKNNELGKALRQIKECRSLWPN
DIFGSSSDDEVQTLLNIYFRHQTLGQTGTYALVGSNHSLTEICTKLMELNMEIRDMIRRA
QNYRVLTAFLPDSSVSGTSL
NT seq 9063 nt   +upstreamnt  +downstreamnt
atggccagccagcaggattccggcttctttgaaatcagtatcaaatatttactgaaatcc
tggagtaacgcttctccagttggcaacggttacatcaaacctccagtcccacctgcttct
ggcacgcacagggagaaaggaccaccggccatgttgccgatcaatgtggacccagacagc
aagccaggagagtatgtcctcaagagtttgtttgtgaacttcaccactcaggccgagcgt
aagattcgaatcatcatggcagagcctttggaaaagccattgacgaagtctctgcagcgt
ggagaagacccccagtttgatcaggtcatcagctctatgagctccctctctgagtactgc
ctgccctccatcctgcgaacactcttcgactggtacaaaaggcaaaacggcattgaggac
gagtcacacgaatacaggccacgaacaagcaataagtccaaaagtgatgaacagcagcga
gactatttaatggagagacgggaccttgccattgatttcatcttttctttagtgttaata
gaagtcttgaaacagatcccccttcatcctgtaattgacagcttaatacatgatattatt
aacttggctttcaagcactttaaatacaaagaagggtacctgggtcccaacactggcaat
atgcacattgtggctgatctgtatgctgaggtcatcggagtgctggcccaagccaagttc
cctgctgtcaagaagaagttcatggcagagctgaaagagctacggcacaaagagcagagc
ccctatgtggtgcaaagcatcatcagcttgataatggggatgaaattcttccgaattaag
atgtaccccgtggaggacttcgaggcgtccctccagttcatgcaggaatgcgcgcattac
tttctggaggtcaaagacaaagacatcaagcatgccttggctgggctctttgtagaaatc
cttgtcccggtggccgctgctgtcaaaaatgaagtcaacgtcccctgcctcaggaacttt
gtggagagcctgtacgatacgacgttggaactctcctctcggaaaaagcattccttggcc
ttatacccactggtgacctgtctcctctgtgtcagtcagaagcagctgttcctcaacagg
tggcatgttttcctcaacaactgcttgtccaaccttaagaataaagaccccaaaatggct
cgcgttgccttggaatctctctacagattactgtgggtttacatgattcgaatcaaatgt
gaaagcaacacggccactcagagccgactcataaccatcaccaccacgcttttccccaaa
gggtcccgcggcgtggtacccagggatatgcctctgaatatctttgtgaagattatccag
ttcatcgcccaggaacgtctggactttgcaatgaaggaaattatttttgactttctctgt
gtgggaaaaccagccaaagctttcagtctcaacccagagagaatgaacatcggtttgcgg
gcgttcctggtgattgctgatagcctacaacaaaaggatggcgagccgcccatgccagtg
acgggagccgtgctcccctcaggaaacaccctgagagtgaagaagacatacttgagtaaa
acactcactgaggaggaagccaaaatgataggaatgtccttgtattactctcaagtccgc
aaggccgtaggcaatatcttaaggcaccttgataaagaagtggggcggtgcatgatgctg
accaacgtccagatgctaaacaaagagccggaagatatgatcacgggcgagagaaagccc
aagatagatctcttcaggacctgtgttgccgcgattcctcgcctgttgcctgatgggatg
tccaaacttgaacttattgacttgctagccagactctctattcatatggatgacgaactg
cgccacattgcacagaactctcttcagggactactggttgacttctctgactggagggaa
gacgtcctgttcggcttcacgaacttcctgctccgggaagtaaatgacatgcatcacacc
ctcctggactcctccctaaagttgcttctgcagttgctcacccagtggaaactggtcata
cagacacagggaagagcctacgaacaagccaacaagatcagaaactcagagctcattccc
aacggctccagccaccgtatgcagtcagaacgaggcccgcactgcagtgtcctccatgct
gtggaaggcttcgctctcgtcttgctctgcagcttccaggtggccacacgcaagctgtcg
gtgctgatactcaaggagatccgagctctcttcctggccctgggtcagcccgaggacgat
gacaggccaatgattgatgtcatggatcagctgagttcttccattcttgaaagcttcatt
catgtggcagtttcagattcggcaacactacctccgacccacaatgtagatctccagtgg
ttggtggaatggaacgcggtcctggtcaacagccattacgatgtgaagagcccctcccac
gtctggatcttcgcgcaatctgtcaaagacccctgggtcctgtgcctcttcagcttcctc
cgtcaggaaaacttgccgaagcattgccccacggccctcagctatgcctggccttacgcc
ttcacccggctgcagtccgtgatgccgctggtagacccaaacagcccagtcaacgccaag
aaaaccagcacagcgagcagcggagacaactatgttaccttgtggagaaattacctcatt
ctctgtttcggagttgccaagcccagtattatgagcccaggacacttacgagcatccact
cctgagataatggcaacgactcccgacggtacagtgagctacgataacaaggccattggc
acaccatcagtgggcgtcctgctgaaacagttggtgcctttgatgaggctggaaagcatt
gaaatcacagagtcccttgttttaggatttggaagaacaaattcccttgttttcagagaa
ttggttgaagaactccatccattaatgaaggaggctctagagagaagaccagagaacaag
aaacgccgagaacggagagatttgctgaggcttcagctgcttcggatattcgaacttctg
gcagacgctggcgtgataagtgacagcacaaatggagctttagaacgagacaccttagcg
cttggagctttgttcttggaatacgtggacttgacccgcatgctcttagaagctgaaaat
gacaaagaggtcgaaattcttaaagacatccgagcacattttagcgccatggttgccaac
ttgatccagtgtgttccagttcatcacagaagatttctcttcccccagcaaagcctacgg
caccatctcttcatcttgttcagccagtgggctggccccttcagcatcatgtttacacct
ctggatcggtacagtgaccgaaaccaccagataacgagataccagtactgtgctctaaag
gcaatgtcggcagtgctgtgctgtggccctgtatttgacaatgtcggcctctctccggac
ggctatctgtataagtggctcgacaatattctggcttgtcaagatttacgagttcatcag
cttggctgtgaggtcgtcatgttgctactggaacttaatcctgaccagataaaccttttc
aattgggccatcgaccgatgttacacaggatcctaccagcttgcttccggctgcttcaaa
gccatagcgactgtgtgcggaaacaggaactatcccttcgacatagtgacactgctgaac
cttgttctcttcaaggcctctgacaccaacagagagatttacgaagtctccatgcagctc
atgcagatcctcgaagcaaagctttttgtgcactccaaaaaggttgcggaacaaagacct
ggcagtattctatacggaacacatggaccgctgccacctctctacagtgtgtcgctagcc
cttctgtcgtgtgagctggcccggatgtaccccgagctcactcttcccctcttctcagag
gtgagccagagattccccacgacacacccaaatggacggcagatcatgctcacctacctg
ttgccatggctacacaacattgaactggtggacagcagactcctcctcccggggtccagt
cccagcagtcctgaggatgaggtcaaggaccgagaaggagaagtgactgcctctcatgga
ctaaaagggaatggctggggctctccggaagctacctctctggtcctgaataacctcatg
tacatgacagccaagtatggagatgaagtcccaggagcagaaatggagaacgcttggaac
gctctggccaacaatgagaagtggagcaacaacctgagggtcacactgcagttcctcatc
agcctgtgcggggtcagcagcgacaccatcctcctgccctatattaaaaaggtggcaacc
tacctgtgtcggaataacaccatccagactatggaagagcttctctttgagctgcagcag
acagagccagtgaaccccatcgtccagcactgtgacaacccacctttctatcgattcacg
gccagcagcaaagcctcagcagctgcttcaggaaccacctccagcagtaacactgtggtc
gccggccaggacagtttcccagaccctgaggagagcaagatactgaaagaatccgatgac
aggtttagcaatgtgatccgagcccacactcgcctggagtcaagatacagcaacagctcg
ggaggctcgtatgatgaggataaaaatgatcccatctctccctacaccggctggttgtta
agtattacggaagccaagcagccacagcccttacccatgccgtgcagtggaggatgctgg
gcccccttggtcgactacctcccagagaccatcactccgagggggccgctgcacaggtgt
aatattgctgtgatctttatgactgagatggtggtggatcacagcgtgagggaagactgg
gctcttcatcttccattgttacttcatgctgtctttttgggtttggaccattatcggcca
gaagtcttcgagcacagcaaaaagctgctgcttcacctcctcatcgccctctcttgcaac
agtaactttcacgccattgcctctgtactcctgcagacccgcgagatgggggaagcgaag
acactaaccatgcagccagcttaccagccggagtatctctacactggcggctttgacttc
ctgagagaggatcagtcatccccagtgccagactctggcctcaactccagttccacctcc
tccagcatcagtctggggggcagcagcgggaacctcccacagatgacccaagaggtggaa
gatgtcgaagcagccactgaaacggacgagaaggccagcaagctcatcgagtttctgacg
accagggcattcgggccactttggtgccacgaagacatcacacccaaaaaccagaactcc
aagagtgctgagcaactctctaatttcctgcgtcacgttgtctctgtgtttaaggattcc
agatcaggtttccatctggagcagcatctgagcgaggttgcgctgcaaactgctcttgca
agctcttccaggcactatgcaggccggtctttccagatcttccgggccctcaaacaacct
ctatcagcgcatgccctgtctgacctcctgtccagattggtggaggtgatcggagagcat
ggtgatgagattcagggatatgtgatggaagcgctcctgaccctggaggccgctgtggat
aacttgtcggactgcttgaagaacagtgacctcttcacagtgttatctcgttcttcatcg
ccagacctaagctccagcagtaaactgacagcgagcaggaaaagcaccggacagctgaac
gtcaatcccgggactcctggcagcggcggaggcggcggcggcagcggcaacaccacgact
gcagagcgaagccggcaccagagaagcttctctgtgcccaagaagttcggtgtcgttgac
cgatcctcagacccgcctcggagcgccaccctggacagaattcaagcttgtacccaacaa
ggcctttcctcaaaaaccagaagcaattcctccctgaaggagagcctcacggacccgtcc
cacgtaagccaccccaccaacctgctggccaccattttctgggtcacggtggccctgatg
gagtctgattttgagtttgaatacctgatggccttacggctcttgaaccgactgctggca
catatgccgctggagaaagctgagaaccgagaaaagctggagaaactccaggcgcagctc
aagtgggcggacttcccagggctacagcagctgctcctgaagggattcacctctctcacc
accacagacctgaccctgcagcttttcagcttgctgacatcagtgtccaaagtccccatg
gtggactcgtcccaagctattggatttccgctgaatgtcttgtgtctcctgcctcaactg
atccagcattttgaaaatcccaatcagttctgtaaggatatagctgaaaggatcgctcag
gtttgcttggaagaaaaaaaccctaaactttccaacctggctcacgtcatgaccctttac
aaaacacacagctacacaagggactgcgccacatgggtcaacgtggtctgtcgctacctt
catgaagcctatgccgacatcaccttgaacatggtcacctacctggcagagttgctggag
aaaggcctccccagcatgcagcagccgctcctgcaggtcatctacagtctactcagctac
atggacctctctgtcgttcctgtcaagcagtttaacatggaagtcctgaagaccattgaa
aaatacgtacagagcattcactggagggaagcgttgaatatcttgaagctggttgtctct
cgatcggccagcctggtattgccttcctaccaacacagcgacctctccaagatagaacta
caccgggtgtggaccagcgcctcaaaggaactgccgggcaagaccctggacttccacttc
gacatctcagagactccaatcattgggagacggtacgatgaactccagaattcctctgga
cgggatgggaagcctagggccatggccgtcacccggagtgcatcctctacctcctccggc
tccaactccaatgtccttgttcctgtgagctggaaaagaccccagtattctcagaaaaga
acgaaagagaagctagtgcacgtcctctctctgtgcggccaggaagtcggactaagcaaa
aacccgtcggtgattttttcctcgtgtggggacctggatcttccggagcatcagacaagc
ctggtgtcatccgaggacggcccccgggagcaggagaacatggatgacaccaacagcgaa
cagcagttcagagtcttcagggacttcgatttcctagacgtggaactggaggacggggag
ggggagagtatggacaacttcaactggggagtgcgcaggcgctccctggacagcctggac
aagtgtgatatgcagatcctggaggagcgccagctctccagaagtactcccagcctaaac
aagatgagccacgaggattccgatgagtcatccgaggaggacctcacagccagccagatc
ctggaacactcagaccttatcatgaacctctccccctccgaggaggcgaatcccatggag
ctgctgaccagtgcctgtgactccgcccccgcagaccctcattccttcaacaccagaatg
gcaaacttcgaggcttctttgcctgatataaataatctgcagatttcagaggggtcaaag
gctgaggcagtccccgaagaggaggacaccaccgtgcacgaagatgatctctcaagctcc
atcaatgagctcccagcagcgtttgaatgcagcgacagcttcagcctggatatgacggag
gcggaggagaaaggaaatcggggcctggaccagtacactctcgccagcttcggagaaggt
gacaggggtgtgtctccccctccctcgcccttcttctcggccatccttgctgcctttcag
cccgccgcctgtgatgacgccgaggaagcctggcgaagccacattaaccagctcatgtgt
gactcagacggctcctgtgctgtgtacacatttcatgtgttctcctctctgtttaagaat
attcaaaagaggttctgcttcctaacctgtgatgcagccagttaccttggagataacctc
cggggaatcgggtccaaatttgtcagctcttcccagatgctcacctcctgttctgaatgc
cctacgctgttcgtagatgcagagactctcctttcctgtgggctcctggacaagctcaag
ttcagtgtgctggaactgcaagaatatctggacacgtacaacaacaggaaagaggccaca
ctctcgtggcttgccaactgtaaggcaacgtttgcaggtggctcgagagatggagtgatt
acctgccaacccggggactcggaagaaaagcaactggagctgtgtcagaggctgtacaag
ctgcatttccagctgctcctgctctatcaatcctattgcaagctcatcggccaggtgcat
gaagtgagctccgtgcccgagctgctgaacatgtccagagaactgagtgatctgaagagg
aacctgaaagaggccactgccgccatcgccacagacccactgtacatcgagggggcgtgg
tcagaaccaaccttcacctccacagaggcggccatccagtccatgctggagtgcctgaag
aacaatgaacttggcaaagccctgaggcagatcaaagagtgcagaagcctgtggcccaac
gacatctttggaagcagttctgacgatgaggtccagacactcctgaatatttatttccgt
caccagactctgggacagacgggtacttatgccctggtggggtctaaccacagcctgact
gaaatctgcaccaagctcatggagctgaacatggagatccgagacatgatccgcagggcc
cagaactaccgggtcctcacagccttcctcccagactccagtgtgtctggcactagtctc
tga

DBGET integrated database retrieval system