KEGG   Mus musculus (house mouse): 320405
Entry
320405            CDS       T01002                                 
Symbol
Cadps2, A230044C21Rik, Caps-2, Caps2, Cpd2
Name
(RefSeq) Ca2+-dependent activator protein for secretion 2
  KO
K19933  calcium-dependent secretion activator
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    320405 (Cadps2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    320405 (Cadps2)
SSDB
Motif
Pfam: MUN PH
Other DBs
NCBI-GeneID: 320405
NCBI-ProteinID: NP_001239034
MGI: 2443963
Ensembl: ENSMUSG00000017978
UniProt: Q8BYR5 A4PI80
Position
6:complement(23262772..23840662)
AA seq 1264 aa
MLDPSSSEEESDEGLEEESREVLVAPGVSQRAPPAAAREGRRDAPGRSGGGSGGGAARPV
SPSPSVLSEGRNEPELQLDEEQERRIRLQLYVFVVRCIAYPFNAKQPTDMARRQQKLNKQ
QLQLLKERFQAFLNGETQIVADEAFCNAVRSYYEVFLKSDRVARMVQSGGCSANDFREVF
KKNIEKRVRSLPEIDGLSKETVLSSWIAKYDAIYRGEEDLCKQPNRMTLSAVSELILSKE
QLYEMFQQILGIKKLEHQLLYNACQLDNADEQAAQIRRELDGRLQLAEKMAKERRFPRFI
SKEMESMYIEELRASVNLLMANLESLPVSKGGPEFKLQKLKRSQNSAFLDLGDENEIQLS
KSDVVLSFTLEIVIMEVQGLKSVAPNRIVYCTMEVEGGEKLQTDQAEASRPQWGTQGDFN
TTHPRPVVKVKLFTESTGVLALEDKELGRVVLYPTSNSSKSAELHRMTVPKNSQDSDLKI
KLAVRMDKPAHMKHSGYLYALGQKVWKRWKKRYFVLVQVSQYTFAMCSYREKKSEPQELM
QLEGYTVDYTDPHPGLQGGQVFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSYKPV
PAVQSQKLNPKGGALHADAQLYADRFQKHGMDEFISASPCKLDHAFLFRILQRQTLDHRL
NDSYSCLGWFSPGQVFVLDEYCARYGVRGCHRHLCYLTELMEHSENGAVIDPTLLHYSFA
FCASHVHGNRPDGIGTVSVEEKERFEEIKDRLSSLLENQISHFRYCFPFGRPEGALKATL
SLLERVLMKDIATPIPAEEVKKVVRKCLEKAALINYTRLTEYAKIEGPAEKETETMNQAT
PARKLEEVLHLAELCIEVLQQNEEHHAEGREAFAWWPDLLAEHAEKFWALFTVDMDTALE
AQPQDSWDSFPLFQLLNNFLRNDTLLCNGKFHKHLQEIFVPLVVRYVDLMESAIAQSIHR
GFEQETWQPVNNGSTTSEDLFWKLDALQMFVFDLHWPEQEFAHHLEQRLKLMASDMIEAC
VKRTRTAFELKLQKANKTTDLRIPASVCTMFNVLVDAKKQSTKLCALDGGQEQQYHSKID
DLIDNTVKEIIALLVSKFVSVLEGVLSKLSRYDEGTFFSSILSFTVKAAAKYVDVPKPGM
DLADTYIMFVRQNQDILREKVNEEMYIEKLFDQWYSNSMKVICVWLADRLDLQLHIYQLK
TLIKIVKKTYRDFRLQGVLEGTLNSKTYDTLHRRLTVEEATASVSEGGGLQGITMKDSDE
EEEG
NT seq 3795 nt   +upstreamnt  +downstreamnt
atgctcgacccgtcttccagcgaggaggagtcggacgaggggctggaggaggagagccgc
gaggtgttggtggcgccgggcgtctcccagcgagcgccgccggccgcggctcgggaaggg
cggcgggacgcgccgggacgctccggtggtggcagcggcggcggagcggccagacccgtg
agcccgagcccctcggtactcagcgaggggcgaaatgagcccgagctgcagctggacgag
gagcaggagcggcgcatccgcctgcagctctacgtcttcgtggtgaggtgcatcgcgtac
ccattcaacgccaagcagcccaccgacatggcccggaggcagcagaagcttaacaaacaa
caattgcagttactgaaagaacggttccaggcctttctcaatggagaaactcagatagta
gcagacgaagccttctgcaatgccgtccggagttactatgaggtgtttctaaagagtgac
cgtgtggccagaatggttcaaagtggaggatgctctgctaatgatttcagagaggtgttt
aagaagaacatagaaaaacgtgtccgtagcctgccagagatagatggcctgagcaaagag
acagtgctgagctcatggatagccaaatatgacgccatttacaggggagaagaagatttg
tgcaaacagccgaacaggatgaccctcagtgccgtgtctgagcttattctgagtaaggag
cagctctatgaaatgttccagcagattctgggcattaagaagctggaacaccagctactt
tataacgcatgccagctggataacgctgatgaacaagcagcccagatcagaagggaactt
gatggccgcctgcagttggcagagaagatggcaaaggagagaagattccccagattcatc
tcgaaagaaatggagagtatgtacattgaagagctgcgagcctccgtgaacctgctaatg
gccaatttagaaagtcttccagtttcaaaaggtggcccggaatttaaattacaaaaatta
aagcgttcgcagaactctgcgtttctggacctgggagatgagaacgagatccagctgtcc
aagtcggatgtggtgttgtcgttcacgttagagattgtcatcatggaagtgcaaggactg
aaatctgtggctcccaatcgaatcgtttactgcacaatggaggtggaaggaggagaaaaa
ctccagacagaccaggctgaagcatcaaggccacaatgggggacccaaggagatttcaac
actacccaccctcggcctgtcgtcaaagtgaagctcttcacagaaagcacgggggtcctg
gccctggaagacaaggaactgggcagggtggtgttatacccaacttctaatagctccaag
tcagcagagttacaccgaatgacagtacccaagaacagtcaggactcggacctaaagatc
aaattggcagtgcgcatggataaaccagcacacatgaagcatagtgggtacctgtatgcc
cttggacagaaggtttggaaaagatggaaaaagcgttactttgttctcgttcaggttagc
cagtacacctttgctatgtgcagctatagagaaaaaaagtcggaaccacaggaattaatg
caactggaaggatacacagtggattacacagaccctcacccaggccttcagggtggtcag
gtgttcttcaacgctgttaaagagggagatactgtgatctttgccagtgatgatgaacag
gacagaatattatgggtacaagccatgtacagggctacaggccagtcttacaaaccagtt
cctgcagtccaaagccagaagctgaatcctaaaggcggagctctccatgcagatgctcag
ctttatgcagaccgttttcagaaacacgggatggatgagtttatttctgcgagtccttgc
aagcttgaccatgccttcctcttcagaattctccagagacagactttggatcacagactg
aatgattcgtattcttgtttggggtggtttagccctggccaagtctttgtgttagatgag
tactgtgcccgctacggagtgagaggctgtcacaggcatctctgctaccttacagaactg
atggaacattcagaaaacggtgctgtcattgaccccaccctgctccattacagctttgca
ttctgtgcctctcacgtgcacggcaacaggcctgatgggattggaacggtttcagtggaa
gagaaagaaagatttgaggagataaaagaccgactttcttcgcttttagaaaaccagatc
agccacttcagatactgctttcccttcggacgacctgagggtgccctaaaagctacgctc
tccttacttgaaagggttttaatgaaagacattgccactcctatccctgcggaggaggtg
aagaaagtggtcagaaaatgtctggagaaagctgccttgatcaattacactaggctcaca
gaatatgccaaaatagaagggcccgcagaaaaggaaacagagaccatgaaccaggcaact
cctgccaggaagctggaagaggttcttcatcttgcagagctctgcatagaagtcctacag
caaaatgaggagcatcatgctgagggaagagaggcatttgcctggtggcctgacttgttg
gccgagcatgcagagaagttttgggctttattcacagtagacatggatactgcgctggag
gcccaacctcaagactcctgggatagctttccccttttccagctgcttaataatttcctc
agaaatgacacacttttgtgtaatggaaaattccacaagcacttgcaagaaatctttgtg
cccttggttgtccgctacgttgacctgatggagtctgccatcgcccagtccattcacaga
ggttttgagcaggagacatggcagcctgtcaacaatggctcaacaacttccgaggatctg
ttctggaagctcgatgcgctgcaaatgttcgtctttgatctccattggccagaacaagag
tttgcccaccacttagagcaaagacttaaactaatggccagtgatatgatagaggcgtgt
gtcaaaagaacaagaactgcgttcgaactcaagctacaaaaggcaaacaaaacaactgac
ttgcgcatcccagcttccgtgtgcacaatgtttaatgtattagttgatgctaaaaagcaa
agcaccaagctgtgtgccctggatggaggacaagagcaacagtaccattcaaaaatagat
gatttgattgacaacaccgtgaaagaaatcattgcactgctggtttcaaagtttgtttca
gtgttggaaggggtgctttcgaagttgtcgaggtatgacgaaggcactttcttctcatcc
atcctgtccttcactgtgaaagcagctgcaaaatatgtggatgtccctaaaccaggaatg
gatctggcagacacctacattatgtttgtccggcaaaaccaggatattcttcgagaaaaa
gtcaatgaagagatgtacatagaaaagttgtttgatcaatggtacagcaattccatgaaa
gtcatttgtgtgtggctggctgacagactagacctccagcttcatatttaccaactgaag
acgctcatcaagattgtgaagaaaacctatagggatttccgattgcagggtgtgttggag
gggacgctgaacagtaagacatatgatactctgcacagacgtctaactgtagaggaggcc
acagcctctgtctcagaaggcggaggacttcagggcattaccatgaaggacagtgatgag
gaggaagaaggctga

DBGET integrated database retrieval system