KEGG   Mus musculus (house mouse): 320452
Entry
320452            CDS       T01002                                 
Symbol
P4ha3, D930031A02Rik
Name
(RefSeq) procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), alpha polypeptide III
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    320452 (P4ha3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     320452 (P4ha3)
SSDB
Motif
Pfam: P4Ha_N 2OG-FeII_Oxy_3 SPO22 TPR_2 DUF1518 TPR_8
Other DBs
NCBI-GeneID: 320452
NCBI-ProteinID: NP_796135
MGI: 2444049
Ensembl: ENSMUSG00000051048
UniProt: H7BX23
Position
7:99934637..99968908
AA seq 542 aa
MGPGARLALLALLALGGDPAAATGREDTFSALTSVARALAPERRLLGTLRRYLRGEEARL
RDLTRFYDKVLSLHEDLKIPVVNPLLAFTLIKRLQSDWRNVVHSLEATENIRALKDGYEK
VEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSSITDLYSPRQLFSLTAD
DCFQVGKVAYDTGDYYHAIPWLEEAVSLFRRAHGEWKTEDEASLEDALDYLAFACFQVGN
VSCALSLSREFLVYSPDNKRMARNVLKYERLLAENGHQMAAETAIQRPNVPHLQTRDTYE
GLCQTLGSQPTHYQIPSLYCSYETNSSPYLLLQPARKEVVHLRPLIALYHDFVSDEEAQK
IRELAEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPMLVTLDHRIAALTGLDIQPPY
AEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMKSGNRVATFMIYLSSVEAGGATAFIYGN
FSVPVVKNAALFWWNLHRSGEGDGDTLHAGCPVLVGDKWVANKWIHEYGQEFRRPCSTNP
ED
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgggcccaggggcgcggctggctctgctggcgctgctggcgctcgggggagaccccgcg
gcggccacggggcgggaggacacgttctccgcgctgaccagcgtggcgcgcgccctggcg
cccgagcgcaggctgctggggacactgaggcgctacctgcgcggcgaggaggcgcggctg
cgcgacttgaccagattctatgacaaggtactttctttgcacgaggacttgaagatccct
gtagtgaatcctctacttgccttcactctcatcaaacgtctgcagtccgactggaggaat
gtggtacatagtctggaggccactgagaacatccgagctctgaaggatggctatgagaag
gtagagcaagaccttcctgcctttgaggacctcgagggagcagcaagggccctgatgcgg
ctgcaggatgtgtacatgctcaacgtgaagggcttggctcgaggcgtcttccagagggtc
acgggctcctccatcaccgacctgtacagtcccaggcagctcttctctctcacagcggat
gactgcttccaagttggcaaggtggcctatgacacaggggattactaccatgccatccca
tggctggaggaagctgtcagtctcttccggagagcccacggcgagtggaagacagaggac
gaggccagtctggaagacgccctggattacttggcctttgcctgtttccaggtaggaaat
gtttcatgtgccctcagcctctctcgagagttccttgtctacagcccagacaataagagg
atggccaggaatgtgttgaaatatgaaaggctcttggctgagaatggtcaccagatggcg
gctgagactgcaattcagaggcccaacgtaccccacctgcagaccagggacacctacgag
gggctatgccagaccctgggctcccagccaacacactaccaaatccccagcctctactgc
tcctatgagaccaattccagcccctacctactgctccagcctgcccgaaaggaggttgtc
cacctacggccgctcatagctctctaccatgactttgtcagtgacgaggaagctcagaaa
atccgagagcttgcagaaccgtggctccagagatcagtggtggcttcgggggaaaagcag
ttgcaagtggagtaccgcatcagcaaaagtgcctggctaaaggacacggttgatccaatg
ctggtgacccttgaccaccgcattgcggccctcacaggccttgacatccagcctccctac
gcagagtatctccaggtggtgaactatggaatcggagggcactatgagcctcactttgac
catgctacgtcgcccagcagccccctgtacagaatgaagtctgggaaccgagtggcaacg
tttatgatctatctgagctccgtagaagctggaggagccacggcttttatctatggcaac
ttcagtgtgcctgtggttaagaatgctgcactgttttggtggaacctgcacaggagcgga
gagggggatggtgacacacttcatgctggctgtcctgtgctggtgggagacaagtgggtg
gccaacaagtggatccacgagtatggacaggaattccgaagaccctgcagcaccaaccct
gaagactga

DBGET integrated database retrieval system