KEGG   Mus musculus (mouse): 320484
Entry
320484            CDS       T01002                                 

Gene name
Rasal3, A430107D22Rik
Definition
(RefSeq) RAS protein activator like 3
  KO
K17634  RAS protein activator-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    320484 (Rasal3)
SSDB
Motif
Pfam: RasGAP C2 PH
Other DBs
NCBI-GeneID: 320484
NCBI-ProteinID: NP_848900
MGI: 2444128
Ensembl: ENSMUSG00000052142
Vega: OTTMUSG00000034066
UniProt: Q8C2K5 Q8CAS7
Position
17; 17 B1
AA seq 1041 aa
MKPECGQTMFRTFWSRSRDSSAMDPPLQSEEDSQTQPSLPSPLTSYRWHTGGSGEKAAGG
FRWGRFAGWGRALSHQEPMVNSQPAPRSLFRRVLSAPPKESRSNRLRFSKTLWGRHKNVA
PLEPKPNPKAPEPELELVADPDLPVAQIPEPPTPDMPVWNIDGFTLLEGKLVMLGEEEGP
RQIRVGSASSENSMQAALGNLKDAVRTPGKTEPEAAGSNQVHNVRKLLKRLKEKKRAKSE
LGAYTPRDGPPSALGSRESLATLSELDLGAERDVRVWPLHPSLLGEPYCFQVTWAGGSLC
FSCRSSAERDRWIEDLRRQFQPSQDNVERQEMWLTVWVHEAKGLPRATVPGVRAELWLDG
ALLARTAPRAGPGQLFWAERFHFEALPPARRLSLRLRSAGPAGATVGRVVLELDEVSIPR
APAAGLERWFPVLGAPAGAVLRARIRVRCLRVLPSERYKELAEFLTFHYARLCGALEPAL
SAQAKEELAAAMVRVLRATGRAQALVTDLGTAELARCGGREALLFRENTLATKAIDEYMK
LVAQEYLQDTLGQVVRCLCASTEDCEVDPSKCPTPELPKHQARLRDSCEEVFENIIHSYN
CFPAELGSVFSSWREACKARGSEALGPRLVCASLFLRLLCPAILAPSLFGLAPEHPAPGP
ARTLTLIAKVIQNLANCAPFGEKEAYMAFMNSFLEDHGPAMQHFLDQVATVDADTTPSGY
QGSGDLALQLAVLHVQLCTIFAELDQKTQDSLEPLPTILRAIEEGRPVPVSVPMRLPRIS
TQVQSSFFSGEKPGFLAPRDLPKHTPLISKSQSLRSFQGAGSWASRRPDEERPQRRPRPV
LRTQSVPARRPTHRRPSAGSKPRPKGSLRMGPAPCGRAWTRASASLPRKPSVPWQRQMDQ
PGDRYQTTGTHRPVGKLAEIQCEVAIFREAQKALSLLVESLSTQVQALKEQQEHFRCQLQ
DLYSRLGAGISKLDSKGGLPSNGSHRLKSLEQRLTEMECSQDQLRDSLQSLQLLSKTPGS
RSQPLPLKAPCVNGADLSMGT
NT seq 3126 nt   +upstreamnt  +downstreamnt
atgaagccagaatgtgggcagacaatgttcagaaccttttggtctcgcagcagagactcc
tccgccatggacccaccgttgcagagtgaagaagattcccaaacgcagccctcgctgccc
tctccgctgacatcctaccgctggcacactggaggcagtggggaaaaggctgctggaggg
ttccgctggggccgctttgcaggctggggaagggccctgagccatcaggagcccatggtg
aacagccagccagcccccagatctctgtttcgtcgggtcctctctgcaccccctaaggag
tcacggtccaatcgcctccggttttccaagaccctgtggggaaggcacaagaacgtggca
ccactggaacccaagccaaatccgaaggccccagagccagagctggagttggtagcagac
ccagatctacccgttgcacagatccctgagcctcccaccccggacatgcctgtttggaac
attgatggctttacccttctcgaaggaaagctggtgatgctcggtgaggaggagggtcct
cgccaaatccgagtgggaagcgccagttcagagaacagcatgcaggcagctttggggaac
ctcaaggatgcagttcggacccctggaaaaactgagccggaagctgctggttccaaccag
gtccacaatgttcggaagttactcaagaggctgaaggagaagaaaagagccaagtcagaa
ctgggagcctacacccctcgagatggacctcccagtgccctcggttccagagaatcgctg
gccacactctctgagctggacctaggtgctgagagggacgtgagagtctggccactgcat
cctagcctcttgggggagccctactgcttccaggtaacctgggcaggtgggagcctctgt
ttctcatgtcgctcgagcgctgagagagaccgttggattgaggaccttcgtcggcagttc
cagccgagccaggacaacgtggagcggcaagagatgtggctgacggtgtgggtgcacgag
gccaaagggctaccccgagcaactgtacccggagtgcgtgcggagctgtggttggatggc
gcgctattggcgcgcactgccccccgtgccggcccaggccaactcttctgggctgaacgc
ttccacttcgaggcgttgccacctgcccgtcgcctgtcgctgcggttgcgcagcgcaggc
ccggcaggggcaaccgtgggcagggtggtgctggagctggacgaggtgagcatcccccgc
gcgcctgccgcgggcctagagcgctggttcccggtgcttggggcgccggcaggtgcggtg
ctacgagcgcggatcagggtgcgttgtctgcgcgtgctgccgtcggagcgctataaggag
ctggccgagttcctcaccttccactacgcgcgcctgtgcggggcgctggagccggcgctg
tctgctcaggccaaagaggagctggcagcagccatggtgcgcgtgctacgagccactggc
cgagcgcaggcattggtgacagacctaggaaccgcagagctggcacgctgtggaggccgt
gaagcactgctattccgagaaaataccttagccacaaaggccattgatgaatacatgaaa
ctggtggcacaggagtacctccaggacaccctggggcaggttgtgcggtgtctctgtgcc
tccactgaggactgtgaagtggaccccagcaagtgcccaacaccagagctgccaaaacac
caagctagactgcgagacagctgtgaggaggtttttgaaaacatcatccattcttacaac
tgtttcccagcagagctgggctccgtgttctcaagttggcgtgaagcatgcaaagcacga
ggctctgaggccctgggcccccggctggtgtgtgcttccctcttcctgaggcttttatgc
cctgccatcttggcacctagcctctttggcctggcaccagagcacccagccccaggccca
gccagaactcttacactcatcgccaaggtcatccagaacctcgccaactgtgccccgttt
ggtgagaaggaagcctacatggcgtttatgaatagcttcctggaagatcatggaccagcc
atgcaacacttcctggaccaggtagctacggtggatgcagataccacacccagtggctac
cagggaagtggagacctggcccttcagttagcagttcttcatgtccagctctgcacaatc
tttgccgaacttgaccagaaaacccaagatagcttggaaccactacccaccatccttcga
gccattgaggaaggccggcctgtcccagtgtctgtaccaatgcgtcttccccggatctcc
actcaggtccaatccagcttcttttcaggggagaaacccggcttcctggcaccccgagac
ctccccaagcacactcccctcatttccaagagtcaatctctgcgcagctttcaaggggca
ggaagctgggccagtcggcggccagatgaggagcggccccagaggcggccgcggccagtg
ctgcgcacacagagcgtccctgccagacgtcctacccaccgtcgcccttctgcaggttcc
aagccgcggcccaaaggctccctacgcatgggccccgcgccttgcggacgggcctggact
agggcttctgcctcgctacctcggaagccatcggtaccatggcagcgccaaatggaccag
ccgggggaccgataccaaactacgggaacgcaccgaccagtgggcaagctagcagagata
caatgtgaggtggctatattccgcgaggcacagaaagctctgtcccttctggtggagtcg
ttgagtacccaagtccaagccttgaaggagcagcaggagcacttccgctgtcagctgcag
gatctgtactccagactgggagctggtatctcaaagttggattctaagggtggtctccca
agcaacggaagccacaggctgaaaagtctggaacagcgcctgactgagatggaatgttct
caggaccagctgagggatagcctccaaagcctgcaacttctttcaaaaacaccaggatct
cggagccagcccctgcctctcaaagcaccatgtgtcaatggagctgatctgtcaatgggc
acttga

DBGET integrated database retrieval system