KEGG   Mus musculus (house mouse): 320487
Entry
320487            CDS       T01002                                 
Symbol
Heatr5a, C230081H03Rik, D930036F22Rik, mKIAA1316
Name
(RefSeq) HEAT repeat containing 5A
  KO
K24814  HEAT repeat-containing protein 5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    320487 (Heatr5a)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   Aftiphilin/p200/gamma-synergin complex
    320487 (Heatr5a)
SSDB
Motif
Pfam: Laa1_Sip1_HTR5 HEAT HEAT_2 Vac14_Fab1_bd
Other DBs
NCBI-GeneID: 320487
NCBI-ProteinID: NP_796145
MGI: 2444133
Ensembl: ENSMUSG00000035181
UniProt: Q5PRF0
Position
12:complement(51922654..52018154)
AA seq 2038 aa
MELAHSLLLNEEASNQLGAVQKAEFIFEWLRYLEKLLLATNREDVREKQKTLVGQLLSLL
NSSPGPPTRKLLAQDLAILYSVGDTVSVYETIDKCNDLIRSKDDSPSYLPTKLAAVVCLG
SLYKKLGRILANGFTDTVVNILKAMKSAESQGRYEIMLSLQSILTGLGAAAAPCHRDVYK
AARSCLTDRSMAVRCAAAKCLLELQNEAIFMWSTDVDSVATLCFKSFEGSNYDVRISVSK
LLGTVLAKAVTAKHPGAGSKQSARRVSLEEVLELLGAGFLRGSSGFLRASGDMLKGNSSV
SRDVRVGVTQAYVVFVSTLGGAWLEKNLAAFLSHILSLVSQSNPKATQTQIDAVCCRRCV
SFILRATLGGLLGEKAQIAAAKEICQAVWRLKKVMDAALSDGNVETRLSSTDVAASQHVL
VCALQELGNLIHNLGTTAAPLLQDSSTGLLDSVISVVLHPSISVRLAAAWCLHCIAVALP
SYLTPLLDRCLERLAILKSSPEAVTGFSSAVAALLGSVTHCPLGIPHGKGKIIMTIAEDL
LCSAAQNSRLSLQRTQAGWLLVAALMTLGPAVVSHHLTRVLLLWKCVFPASPRDLETEKS
RGDSFTWQVTLEGRAGALCAVKSFISHCGDLLTEEVIQRLLPPLPCAVDLLTQLSSILKT
YGSSLKTPSIVYRQRLYELLILLPPETYKGNLCVILKELAAELTAPDTQAAASTCLLPAL
CHPDDLLILSPLLQETDHRFIEEQLLLGNGVACGSLEYDPYSIYEKDVEGDSVPKPLPPA
LSVISSASKLFGVVCATVDEAQRVLILEQLLNSIKHTKGARQQTVQLHVVSAISNLLKYV
AGSKQSLGPEVRRLVLTLVLGALESPTPLLRCAASEAWARLAQVADDGAFTAGLAQLSFD
KLKSARDVVTRTGHSLALGSLHRYLGGIGPQHLSSCIGVLYTLSQDSTSPDVQTWALHSL
SLTIDSAGALYHVHVESTLSLIVMLLLNVPPTHAQVHQSLGRCLNALITTLGPELQGSNT
SVSALRTSCLLGCAVMQDHPGCLVQAQAISCLQQLHMFAPRHVNLSSLVSCLCVNLCSPY
LLLRRAVLACLRQLVQREAAEVSEHAIMLARDGRDAAADANLREVGLEGALLALLDRETD
ESLCQDIRETLHHMLTSMAVGKLTLWLKLCKDVLAASADFTAVTCVDTMQEEEGDRGDDA
SVLTRGDDKPHPFSNPRWATRVFAADCVCRIINQCENANRAHFDIALAQEMKKRDSRNDF
LVLHLADLIRMAFMAATDHSDQLRLSGLDTLLVVIRRFADIAEPEFPGHVILEQYQANVG
AALRPAFTSETPPDITAKACQVCSAWIASGVVSDLSDLRRVHQLLVSSLTKIQAGKEALS
QLYNESASTMEILAVLRAWAEVYIIAVQRHKNHKQALKTTVNSEDSMRNGSSSAAGLLDL
VCTDLATLSKLWLAALQDFALLTLPAEFASQLPTEGGAFYTAETSKSAKLHYHDSWALIL
HAAALWLTSTGFADPDEGGANLSRPVTPTSMCQGSSSSGAAVKSPEDVYTDRFHLILGIS
VEFLCSLRSDASLESIMACLRALQALLDVPWPRWRIGSDQDLGIELLNVLHRVILTRESP
AIQLASLEVVRQIICAAQEHVKEKRRSAEVDDGASEKETLPEFGEGKDTGGLVPGKSLVF
ATLELCVCILVRQLPELNPKLAGSPGGKASKPKTLLEEGSRLVAAALAILAELPAVCSPE
GSISILPTVLYLTIGVLRETAVKLPGGQLSCTVTASLQTLKGILTSPMARAEKSHEAWTS
LLQSALATVLDCWSPVDGAQEPDEVSLLTAVTVFILSTSPEVTTVPCLQNRCIEKFKAAL
ESKDSVVQMKTCQLLHSIFQYPKPAVSYPYIYSLASSIVEKLQDIARRKPEDATELQLCQ
EGIKLLEALVAIAEEEHRAQLVACLLPILISFLLDENALGSATSVTRSLHDFALHSLMQI
GPRYSSVFKRVMASSPALKARLEAAVKGNQESVRVDPPSKHAKNLARNSSIQLKTNFL
NT seq 6117 nt   +upstreamnt  +downstreamnt
atggaattggctcacagcttgctgctcaatgaagaagcatccaatcagctaggtgccgtt
cagaaggctgagtttatttttgagtggttgagatacttggagaagctcttgctagcaaca
aacagggaggacgtcagggagaagcagaagactcttgttgggcagctcctgtccttgctg
aacagctccccgggaccccccacgcgcaagctccttgctcaggacctggccatcctttat
agtgttggagacacagtctctgtttatgagacgatcgataaatgtaatgatcttattcgg
agcaaagatgactctccaagttaccttcccaccaaacttgctgctgtggtgtgcttgggt
tccttgtacaagaaattgggtagaatcctggctaatggcttcactgacactgtggtgaat
attcttaaagcgatgaagagtgcagagtctcaaggccgctatgagatcatgctgagtctg
cagagtatactgactgggctgggtgctgccgctgcaccgtgccacagggacgtttacaag
gctgcccggtcctgcttaacagacagatccatggctgtccgatgtgctgctgccaagtgt
cttcttgaactccagaatgaggccatctttatgtggagcacagacgtggacagtgtggcc
acactatgttttaagtcctttgaaggttccaattatgacgtgcggatatcagtttcaaaa
ctgttgggtacagtgttggctaaagctgtaactgctaagcatccaggagcaggctcaaag
cagagtgctcgtagagtgtcactggaggaagttctggaactgctgggagcagggtttctg
cgtgggagttcaggattccttcgagccagtggagatatgctgaaaggaaacagttcagtc
agcagagacgttcgagtcggagttactcaggcttacgtggtatttgtttcaacattagga
ggagcttggctagagaagaatcttgctgcctttctttcccacatcctaagccttgtatca
cagtcaaatcctaaagccacacagacgcagattgacgccgtctgctgtcgccgctgtgtc
tcattcattcttcgagcgactctaggaggcctgcttggagagaaggcgcagatagctgct
gcaaaggagatctgccaggcagtctggaggctaaagaaagttatggatgccgcattgagt
gatggtaatgtggagacccgtctcagttccacggatgtagccgccagccagcatgtgctg
gtttgtgctttacaagaacttggaaatctgatccacaaccttggcactacagctgcgcct
ttgctccaggattccagcacaggccttctggacagcgtcatctcggtggttctgcaccct
agcatttctgttcgactggctgcagcctggtgcttgcactgcattgcggtggccttgccg
tcctacctgacacctctcttagatcgttgcctagaacggctcgcaatactcaagtcttca
ccagaagcagtgactggctttagttctgctgtggcggccttgctcggttcagtgacacac
tgtcctttgggaattcctcatggaaagggcaagattatcatgacaatagcagaggatttg
ctgtgttccgctgctcaaaacagccgcctgtcacttcagcgcacacaagcgggatggctg
ttggttgctgctctcatgacgctaggtcctgccgtggtcagtcaccacctcactcgagtt
ctgctgctgtggaagtgtgtctttccagcgtcccccagagatctagaaacagaaaagagc
cgaggagactcgtttacctggcaagtgaccctggaaggccgagccggtgctctctgtgct
gtcaagagtttcatttcgcactgtggtgatctccttactgaggaagtcatccagcgactc
ctgccgccgcttccctgtgctgtggatctgctgactcagctttcttcaatactaaaaaca
tatggaagttctttgaaaacaccgtcaatagtttatagacagagactttatgaactacta
attttattacctcctgagacctataaagggaacctctgtgttatcctcaaagagctggct
gccgagctgacggcccctgatacccaagcagcagcatcgacgtgcttactgccagccctt
tgccatccggatgacctcttgatattaagtcctttgctgcaggagaccgaccataggttt
attgaagagcagctcctgcttggcaatggtgttgcctgtggaagtctagaatatgaccct
tattctatttatgagaaggacgtagaaggagactctgtgcctaagcccctgcctccagca
ctgtctgtgattagctctgcatccaagctctttggggttgtctgtgctactgtggatgaa
gctcagagggttctgatactggagcagcttttgaacagcataaagcacaccaaaggagct
cgtcagcaaaccgttcagttgcatgttgtttctgccatttccaacttactgaagtatgtg
gctggctctaagcaaagcttaggtccagaggtgagaagactcgtcctaaccctagtgttg
ggagcactcgaaagccccacccccctgctgagatgtgcagcttcggaagcatgggctagg
ttagcccaagtggctgatgatggagcctttactgctgggttagctcaacttagcttcgac
aaattgaagtcagcgagagatgtggttaccagaacaggccactcactggctctgggatcc
ctgcataggtacttagggggcatagggcctcagcacttgagttcttgcattggagtcctt
tataccctgtctcaggacagcacttctcctgacgtgcagacctgggcactccactccttg
tcactgaccattgattctgcgggtgcactctatcacgtgcatgtggagtctaccctgtca
ctcatcgtcatgttgttgctaaatgtgcctccaactcatgcgcaagttcaccagagtctt
ggtcgctgcttgaacgccctcattaccacgttaggcccagagctacaaggtagcaatact
tccgtgtccgccttaaggacgtcctgtctgctgggctgtgcagtgatgcaggatcaccca
ggctgcctggtccaggctcaggccatctcttgccttcagcagcttcacatgtttgcccca
cgccatgtcaacttgtctagtctggtcagctgcctctgtgtgaatctttgtagcccctac
ctgttgctgcgaagagcagttctggcttgtttgcggcagctggtacagagagaagcagct
gaagtttcagagcatgccatcatgctggccagggatggcagggacgccgctgcagatgct
aacctcagagaagtgggccttgaaggggcgctgttagccttactggatagagagaccgac
gaaagcttgtgccaggatatcagagagacattgcatcatatgctgacgtccatggcagta
gggaagctcaccctttggctgaagctttgtaaagatgtgcttgccgcatccgctgacttt
acagctgtaacttgcgtggatacaatgcaggaggaagaaggcgacagaggtgacgatgcc
tcggttttgaccagaggggatgacaagccacaccctttcagtaatcctcgatgggccact
agagtctttgctgctgactgtgtctgcagaataattaaccagtgtgaaaatgcaaacaga
gctcattttgacattgctttagcacaagaaatgaaaaaacgtgattcaagaaatgatttt
ttggtgctccatcttgctgacttgatccgcatggctttcatggctgccacagaccacagt
gaccagctccgtctctctggccttgacacactcttggtagttatccgacggtttgcagat
attgcagagccagagtttccgggtcatgtgattctggaacagtatcaagccaatgttgga
gccgctcttagaccagccttcacttcagagacaccacctgacatcaccgccaaagcatgt
caggtttgcagtgcttggatagcaagtggggttgttagtgacctcagcgatctccgcaga
gttcatcagctacttgtctcttccctgacgaagattcaggctggaaaagaagctctcagc
cagctgtacaatgagagtgcctccaccatggagatcttagctgtgctgagagcctgggca
gaggtctatataattgctgtacaaagacataaaaatcacaagcaagccttgaagactact
gttaattctgaagacagtatgagaaacgggtcctcttcagctgctggtcttcttgactta
gtctgcactgacctggccacgctaagcaaactctggcttgctgcacttcaggattttgct
ctcttaactttgcctgcagaatttgcttcccagcttcctactgaaggtggtgctttctac
acagcagagacgagcaagagtgcaaagctacactaccacgactcctgggccctcatcctc
cacgctgcggccctgtggctcaccagcacgggcttcgctgacccagatgaaggcggtgcc
aatctctcaaggcctgtaactccaacatccatgtgccagggctcatcatcatcaggagct
gccgtgaagtcccccgaggatgtctacactgacaggttccatctgattctaggaatcagc
gtggagttcctgtgttccctgcgctcagatgcaagcttggaaagcatcatggcttgtctg
cgtgcactgcaggccctgctcgatgttccttggcccaggtggagaattggcagtgatcag
gacttgggtattgaattgctaaatgtactacaccgagtaattttgaccagagagtcacca
gccattcaactggcttcacttgaagtggtcaggcagattatctgtgccgcccaagaacat
gtgaaggaaaaaagacgtagtgcagaagttgatgatggagcctctgagaaggaaaccctg
ccagagtttggtgaagggaaggacacaggaggactcgtacctgggaagtctttggtcttt
gcaaccctggaactctgtgtctgcatcctcgttagacagctcccagaactgaaccctaag
ctggcaggtagcccaggaggaaaggcttcaaagccgaagaccctgttggaggagggaagt
agactggtggcggctgccctggccatccttgctgagcttcctgcagtgtgctctcctgaa
ggcagcatctcaattctccctacagtattgtaccttaccatcggagtcctccgggaaacg
gctgtgaagttacctgggggccagttatcctgcacagtcacggcttccctgcagactctg
aaaggaatcttaacttcccccatggcccgggcagaaaagagccacgaagcttggaccagc
ctcctccaaagtgcattagcaactgtgcttgactgctggagcccagttgacggagcacaa
gaacctgatgaagtcagtctgcttactgccgtcacagtatttattttgtctaccagccca
gaagtgacaaccgtcccctgccttcagaatcgctgcattgaaaaatttaaggctgccctg
gagagcaaggactctgtggtgcaaatgaagacctgtcagctcctccactccatttttcag
tatccaaagccggccgtttcctacccatacatttattccttagcatcttctatcgtggag
aagcttcaggacatagccaggaggaaacccgaagatgctaccgagctgcagctctgtcaa
gaaggaataaagctcttagaagctttggtcgccattgcggaagaagagcaccgcgctcag
ctggtggcctgccttctgcccatcctcatctccttccttttggatgagaatgctctggga
tcagcaacttcagtaacgagaagtctgcacgactttgctttgcacagtctcatgcagatt
gggcctcggtactcgtctgtgtttaaaagagtcatggcttcttccccagccctgaaagcc
cggctggaggctgctgtaaaaggcaatcaggaaagtgtccgagtggatccgccttctaag
catgccaagaacctggccaggaactccagcatccagctaaagaccaatttcctgtga

DBGET integrated database retrieval system