KEGG   Mus musculus (mouse): 320492
Entry
320492            CDS       T01002                                 

Gene name
A830018L16Rik
Definition
(RefSeq) RIKEN cDNA A830018L16 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF5586 Glycoprotein_G
Other DBs
NCBI-GeneID: 320492
NCBI-ProteinID: NP_796147
MGI: 2444149
Ensembl: ENSMUSG00000057715
Vega: OTTMUSG00000033915
UniProt: Q8BZJ8
Position
1; 1 A2
AA seq 459 aa
MASRQQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNQGQLQRALS
GSAALWAESESSEPKGTRRDFRSYDKPWQMNAKKPKKSKSDLAVSNISPPSPDSKSLPRS
VDHLKWNWRTKPQSRDFDELNHILQESKKLGKALENLSRSIAISDELDKETLAFNSSLLR
PRVIGEWIGRAENDADPLAAEMLQPPVPRSKNDSWESEDSSSSPAGSLKMEPKTKGLKQQ
QQQHKKLLAAMLSQDSFESIHSPTPSVIEEDIDNEDDAMELLENLDDLRMEGVTTLVLSG
SKFNQGRPTHPAEPQAKVTLNICSRLQGDNLMERTEDTLQILHTPDEIIPDSLDSLPGTE
ETLMEEGEDFEKTSNLTEPGEASSGAHSLKSYMEEDESLKQLQVVHQPWLLPSDTESEGI
EAEQDKRSADLLCVPCSSCPTLIYSGLSVKPAKEVASGP
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggcatctcgtcaacaaacccgaatccaggcttacctggagaaaaacaagatcggtcct
ctgtttgaggaattaatgaccaagttaataactgagacacctgaccagccaattccattt
ctcattgaccatcttcaatctaaacaaggaaaccaaggacaactgcaaagagctttgtca
gggtcagcagctctctgggcagaaagtgaatcatcagaacccaaaggaacgagaagggat
tttagaagctatgataaaccttggcagatgaatgcaaagaagcctaaaaaatcaaaaagt
gatctggctgtatctaatatttctcctccatcaccagactccaaatcattgccaaggtca
gtagaccatcttaagtggaactggcggactaaaccacaaagccgtgattttgatgaattg
aaccacatccttcaagagagcaagaagctggggaaagcccttgagaatctctctcgaagt
atcgcgatttcagatgaacttgataaggaaacattggctttcaattcctctcttctgaga
cctcgtgtgattggggagtggatcggcagggcagaaaatgatgctgatccccttgcagct
gaaatgctgcagccgccggttccgcggagtaagaatgactcatgggaaagtgaagacagc
agctccagtccagcaggaagcttaaagatggagcccaagacgaaaggattaaaacagcag
cagcagcagcacaagaaactcctggctgcaatgctttcccaggactccttcgagtccatc
catagccccacaccatctgtaatagaagaagacattgataatgaagacgatgcaatggag
ttgctggaaaatctggatgacttaaggatggagggtgtaaccactctggtactttcgggg
agcaaatttaaccaaggtcgtcctactcaccctgccgagccacaggccaaagtcacactg
aacatctgttcaaggcttcaaggagacaacttgatggaaagaacagaagacacactacaa
atacttcatactccagatgagataatcccagactcattagattctttacctgggacagaa
gaaactcttatggaggaaggtgaagattttgagaaaacatcaaacttaacagaaccagga
gaagcctctagtggagcacactctttgaaatcctacatggaagaagatgagtctttgaag
caattgcaggttgtgcatcagccatggcttttaccaagtgacacagaaagtgaaggaatt
gaagcagagcaagacaaacgttctgctgatcttctctgtgtgccatgctcgtcctgtcct
accctgatctattcaggtctgtctgtgaaaccggcaaaggaagttgcaagtggtccttaa

DBGET integrated database retrieval system