KEGG   Mus musculus (house mouse): 320508
Entry
320508            CDS       T01002                                 
Symbol
Cachd1, 1190007F10Rik, B430218L07Rik, Vwcd1, mKIAA1573
Name
(RefSeq) cache domain containing 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: VWA_N dCache_1 VWA
Other DBs
NCBI-GeneID: 320508
NCBI-ProteinID: NP_932154
MGI: 2444177
Ensembl: ENSMUSG00000028532
UniProt: Q6PDJ1
Position
4:100633876..100860946
AA seq 1288 aa
MAREPEEEETVRPAAVVRRCPRCPGWPGAPRPPLWLLCLVACWILGAVADADFSILDEAQ
VLASQMRRLAAEELGVVTMQRIFNSLVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRN
KQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTVSCDRLSTTVNSRAFNP
GRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQS
KHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADAVRTCSLDQCYKTYL
SPATSETKRKMSTFVSSVKPSDSPTQHAVGFHRAFQLIRSTSNSTRFQANTDMVIIYLSA
GITSKDSSEEDKKATLRVINEENGFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSG
KYGIPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLI
MTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPY
LLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIITVPVNSSLSWHINKLRETGKEAY
NVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQ
LATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVM
ATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVAN
PGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLP
VCNQDGGNKIRCFIMEDRGYLVAHPTLVDPKGHAPLEQQHITHKEPLVANDILNHPNFVK
KNLCNSFSDRTVQRSYKFNTSLVGDLTNLVHGSHCSKYRLTRIPGTNAFVGIVNETCDSL
AFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYT
AIDPGLQDALQQCVNSRCNQRMESGDCFGVLDCEWCVVDSDGKTHLDKSYCAPQKECFGG
IVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSH
QHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVMERHVHSPERRRRYW
GRSGTESDHGYSTMSPQEDSENPPCNNDPLSAGVDVGNHDDDLDLDTPPQTAALLSHKFH
HYRPHHPTLHHSHHLQAAVTVHTVDAEC
NT seq 3867 nt   +upstreamnt  +downstreamnt
atggcccgcgagccggaggaagaggagaccgtaaggccggccgctgtggtccgccgctgt
cctcgctgccctggctggcctggggccccgcggccgcccctttggctgctctgccttgtg
gcatgctggatcttgggcgccgtggccgacgccgacttctccatcctggacgaggcgcaa
gtgctggcgagccagatgcggaggctggctgccgaggagctgggggtggtcaccatgcag
aggatcttcaattcgttggtttacacagagaagatctcaaatggagagagcgaagttcag
cagctagccaaaaaaatccgggagaagttcaaccgctacctggatgtggtcaatcggaac
aagcaagtggtagaagcctcctatacagcccacctgacatccccgctgaccgccatccag
gactgctgcacaattccgccttccatgatggagtttgatgggaacttcaacaccaatgta
tcaagaacagtgagttgcgatcgactctctactaccgtgaacagccgagccttcaaccca
ggacgagacttaaattcggttctcgcagacaacctgaaatctaaccctggaatcaagtgg
caatatttcagctcagaagaagggattttcaccgtcttcccagcacacaagttccggtgt
aagggcagctacgagcaccgcagtcgacccatctacgtctctaccgtccggccacagtcc
aagcacatagtcgtgattctggaccatggggcctcagtcacggacacccagctccagatt
gccaaggacgccgcccaggtcatcctcagtgccattgatgagcatgacaagatttctgtg
ttgactgtggcagacgctgtcaggacctgttcgttggaccagtgctataagacgtacctg
tctccagccaccagtgagaccaaaaggaaaatgtccacatttgttagcagcgtcaagccc
tccgacagccccacccagcacgcagtaggctttcacagggcgttccagctgattcgaagc
accagcaacagcactcggttccaagcaaacacagacatggtcatcatttacctgtcagca
ggcatcacatcaaaggactcctcggaagaagataaaaaggcgactctccgcgtcatcaac
gaagaaaatggctttctgaacaactccgtaatgattcttacctacgccctcatgaacgat
ggggtcactggtttgaaagagttggcgttcctcagggatctggctgaacagaactctggg
aagtatggaatcccagaccggacagccttgcctgtgatcaaaggcagcatgatggtgctg
aaccagctgagcaacctggagaccacagtcggcaggttctacactaaccttcccaaccgg
atgattgatgaggctgtcttcagcctccccttctctgatgagatgggagatggtttgata
atgactgtgagtaaaccctgttactttggaaacctcctcctgggaatcgtaggcgtggac
gtgaatctggcttacatccttgaagatgtgacatattaccaagactctttagcttcctat
actttcctcatagatgacaaagggtatactcttatgcatccgtctctcaccaggccatac
ttactgtcagagcctccccttcatactgacatcatacattatgaaaacatccccaagttt
gaattggttcggcaaaatatcctaagcctccctctcggcagccagattatcactgtccct
gtgaactcgtccctgtcttggcacatcaacaagttgagggagactgggaaggaggcctac
aacgtgagctacgcctggaagatggtacaggacacttccttcattctgtgtattgtggtg
atacaaccggaaatacccgtcaaacaattgaaaaacctcaacactgtaccgagcagcaag
ctcctgtaccaccgactggatcttctgggccaacccagtgcttgcctccacttcaagcag
ctggcaacactagaaagtccaaccgtcatgctgtctgccggcagcttttcctccccctat
gagcacctcagccagccagagaccaaacgcatggtggagcattacacggcctatctcagt
gacaacacgcgcctcattgctaacccggggctcaaattctctgtcagaaatgaagtaatg
gcgaccagccacgtcacagatgaatggatgacacaaatggaaatgagcagcctgaacacg
tacattgtccgccgttacatagcaacacccaatggcgtcctcagaatttatcctggttcc
cttatggacaaagcatttgatcccactaggagacagtggtatcttcatgcagtagccaat
ccagggctgatttccttgacgggcccttacctggatgttggaggagctggctatgtcgtg
acaatcagccacacaattcactcatccagtacacagctgtcttccgggcacaccgtggct
gtgatgggtatcgacttcacactgaggtacttctacaaggttctgatggacctcttacca
gtttgtaaccaagatggtggcaacaaaataaggtgcttcataatggaggacagaggctat
ctggtggctcatccgaccctcgttgaccccaagggtcatgcacctctggagcagcaacac
attacccacaaggagcccctggtagcaaatgatatcctgaaccatcccaactttgtgaag
aagaacttgtgtaacagcttcagtgaccggacagtgcagagatcttacaaattcaacact
agcctggtgggggatttgacgaaccttgtgcacggcagccactgctctaagtaccgcctg
acaaggatcccaggaaccaacgcgtttgtcggcatcgtcaacgagacctgcgactctctt
gccttctgtgcttgcagcatggtggaccgtctctgtctcaactgccaccgaatggagcaa
aatgaatgtgaatgtccttgtgagtgccccctggaggtcaatgagtgtactggcaacctc
accaatgcagagaacagaaacccgagctgtgaggttcaccaggagccagtgacatacacg
gctatcgacccaggcctgcaagatgccctgcagcagtgtgtcaacagcagatgtaaccag
aggatggaaagtggggactgtttcggtgtgctggactgcgaatggtgtgtggtggacagt
gatggaaagactcacctggacaaatcctactgtgcgccccagaaagaatgcttcgggggg
atcgtgggagccaaaagtccctatgttgatgacatgggagccatcggtgatgaggtgatc
acactaaacatgattaagagtgctccggtgggccctgtggccggaggcatcatgggctgc
atcatggtgctggtccttgccgtgtatgcttaccgccaccagatccatcgccgcagccac
cagcacatgtcacctcttgctgctcaagaaatgtcagtgcgtatgtccaacctggagaat
gacagagatgaaagagacgatgacagtcatgaagacagaggcatcatcagcaacacccgg
ttcatagctgcagtcatggagcgacacgtacacagtccagaaaggaggcgacgctactgg
ggccgctcgggaactgaaagtgatcatgggtacagcaccatgagcccacaggaagacagc
gagaaccctccatgcaacaatgaccctttgtcagctggggtggacgtagggaaccatgat
gacgacttggacctggacaccccgcctcagactgcagccctgctgagccacaagttccac
cactaccgcccacaccacccgactctccatcacagccaccacctgcaggcggcagtgacc
gtgcacactgtggatgctgagtgctaa

DBGET integrated database retrieval system