KEGG   Mus musculus (mouse): 320701
Entry
320701            CDS       T01002                                 

Symbol
Tafa4, C130034I18Rik, Fam19, Fam19a4, Fam19a4_Tafa-4, Taf, Tafa-4
Name
(RefSeq) TAFA chemokine like family member 4
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TAFA
Other DBs
NCBI-GeneID: 320701
NCBI-ProteinID: NP_796207
MGI: 2444563
Ensembl: ENSMUSG00000046500
Vega: OTTMUSG00000057697
UniProt: Q7TPG5
Position
6; 6 D3
AA seq 135 aa
MRVCAKWVLLSRWLVLTYVLMVCCKLMSASSQHLRGHAGHHLIKPGTCEVVAVHRCCNKN
RIEERSQTVKCSCFPGQVAGTTRAQPSCVEAAIVIEKWWCHMNPCLEGEDCKVLPDSSGW
SCSSGNKVKTTKVTR
NT seq 408 nt   +upstreamnt  +downstreamnt
atgagagtctgtgctaagtgggtgctgctgtcacgctggctggttctgacctatgtgtta
atggtctgctgtaagctgatgtccgcctcgagccagcacctccggggacatgcaggtcac
cacctgatcaagccaggtacctgcgaggtggtcgccgtgcaccgctgctgcaataagaac
cgcatagaggagcgctctcagacggtcaaatgttcctgcttcccaggccaggtggctggc
acaactcgggcacagccttcttgtgttgaagctgccattgtgattgagaagtggtggtgc
cacatgaatccttgcttggaaggagaggactgtaaagtgcttccagactcttcgggttgg
tcctgtagcagtggcaataaagtcaaaaccaccaaggtgacccggtag

DBGET integrated database retrieval system