KEGG   Mus musculus (house mouse): 320705
Entry
320705            CDS       T01002                                 
Symbol
Bend6, B230209C24Rik
Name
(RefSeq) BEN domain containing 6
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: BEN Prefoldin_2 FlaC_arch TSC22 DUF5725 CCDC-167 K-box
Other DBs
NCBI-GeneID: 320705
NCBI-ProteinID: NP_796209
MGI: 2444572
Ensembl: ENSMUSG00000042182
UniProt: Q6PFX2
Position
1:complement(33891133..33946925)
AA seq 281 aa
MQKILQTDDITDNQVLRKRKRKRTETANSENANSALEKAQRDPYSGNAFLPGESSSDEET
PLMELSKEELCNKIESLKEKLRSIRKENSRLRQSLVMLQVLPQAVTQFEELVGMAETLLK
SGGAVSTPASTLWRATNNSSPDSFASLCSNSNSTSSSPSSVKAEEEQHPGEKQFTIERWQ
IARCNKSKPQKFINDLMQVLYTNEYMATHSLTGAKSSTSRDKVVKPAMNQNEVQEIIGVT
KQVFPSADDVSIRRMIGQKLNNCTKKPNASKAPNSQDGILK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgcagaagatcttgcagacagatgacatcaccgacaaccaagttcttagaaaaagaaag
aggaaacggacagagacagcaaactcagaaaatgcgaatagtgctctggagaaagcacag
agagacccatattcaggaaatgctttcctgcctggggagagttccagcgatgaggaaact
cccttaatggaactgtccaaggaggaactttgtaacaaaatcgaaagcctgaaagaaaaa
ctaagaagcatccggaaggaaaacagccggcttcgacagtctttggtcatgctgcaagtg
ttacctcaggcagtcacacagtttgaagaactggttggaatggcagagaccctccttaag
agtggaggagccgtgtccacaccagcgtctactctctggagagcaacaaacaactcctcc
ccagattcgtttgcctctctgtgcagtaattccaactctacttccagctccccaagttcc
gtgaaggctgaggaagagcagcatcctggtgagaagcagttcacgattgagagatggcag
attgcccgttgtaataagagcaagcctcagaaatttattaatgatttaatgcaagtactt
tacacgaatgagtacatggccacacacagtctgacgggggcaaaatcctccacttcaagg
gacaaggttgtcaaaccagctatgaatcagaatgaagttcaagaaatcataggagtaacg
aagcaggtgtttcccagtgcggatgacgtctcaatcagacggatgataggacagaagctg
aacaactgcacgaagaagccgaacgcgagcaaagctccgaactctcaggatggtatctta
aaataa

DBGET integrated database retrieval system