KEGG   Mus musculus (house mouse): 320706
Entry
320706            CDS       T01002                                 
Symbol
Soga1, 9830001H06Rik, D430036N24Rik, Soga
Name
(RefSeq) suppressor of glucose, autophagy associated 1
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: SOGA DUF4482
Other DBs
NCBI-GeneID: 320706
NCBI-ProteinID: NP_001158135
MGI: 2444575
Ensembl: ENSMUSG00000055485
UniProt: A2ACV6
Position
2:complement(156852361..156921185)
AA seq 1654 aa
METPAGESSARGYGPPPAPAPAAERKKSHRAPSPARPKDVAGWSLAKGRRGTGPGSATAC
GTASSARPDKKGRAVAPGTRGTGPRVAGVRTGVRAKGRPRPGTGPRPPPPPPSLTDSSSE
VSDCASEEARQLGLELALSSDAESAAGGPAGTRTGQPPQPAQSGQQPPRPPASPDEPSVA
ASSVGSSRLPLSASLAFSDLTEEMLDCGPGGLVRELEELRSENDYLKDEIEELRAEMLEM
RDVYMEEDVYQLQELRQQLDQASKTCRILQYRLRKAERRSLRAAQTGQVDGELIRGLEQD
VKVSKDISMRLHKELEVVEKKRMRLEEENEGLRQRLIETELAKQVLQTELDRPREHSLKK
RGTRSLGKTDKKPTAQEDSADLKCQLHFAKEESALMCKKLTKLAKENDSMKEELLKYRSL
YGDLDAALSAEELADAPHSRETELKVHLKLVEEEANLLSRRIVELEVENRGLRAEMDDMK
DHGGGGGPEARLAFSSLGGECGESLAELRRHLQFVEEEAELLRRSSAELEDQNKLLLNEL
AKYRSEHELDVTLSEDSCSVLSEPSQEELAAAKLQIGELSGKVKKLQYENRVLLSNLQRC
DLASCQSTRPMLETDAEAGDSAQCVPAPLGETLEPHAARLCRAREAEALPGLREQAALVS
KAIDVLVADANGFSVGLRLCLDNECADLRLHEAPDNSEGPRDAKLIHAILVRLSVLQQEL
NAFTRKADVALGSSGKEQPEPFPALPALGSQGPAKEIMLSKDLGSDFQPPDFRDLLEWEP
RIREAFRTGDLESKPDPSRNFRPYRAEDNDSYASEIKDLQLVLAEAHDSLRGLQEQLSQE
RQLRKEEADSFNQKMVQLKEDQQRALLRREFELQSLSLQRRLEQKFWSQEKNILVQESQQ
FKHNFLLLFMKLRWFLKRWRQGKVLPSEEDDFLEVNSMKELYLLMEEEEMNAQHSDNKAC
TGESWTQNTPNECIKTLADMKVTLKELCWLLQDERRGLTELQQQFAKAKATWETERAELK
GHASQMELKAGKGASERPGPDWKAALQREREEQQHLLAESYSAVMELTRQLQLSERHWSQ
EKLQLVERLQGEKQQVEQQVKELQNRLSQLQKAAEPWVLKHSDMEKQDNSWKEARSEKTH
DKEGVSEAELGGTGLKRTKSVSSMSEFESLLDCSPYLAGGDARNKKLPNGPAFAFVSTEP
VEPEKDAKEKAGLSTRDCSHIGSLACQEPAGRQMQRSYTAPDKTGIRVYYSPPVARRLGV
PVVHDKEGKILIEPGFLFTTAKPKESAEADGLAESSYSRWLCNFSRQRLDGGSGASTSGS
GPAFPALHDFEMSGNMSDDMKEITNCVRQAMRSGSLERKVKNTSSQTVGVATVGTQTIRT
VSVGLQTDPPRSSLHSKSWSPRSSSLVSVRSKQISSSLDKVHSRIERPCCSPKYGSPKLQ
RRSVSKLDSTKDRSLWNLHQGKQNGSAWARSTTTRDSPVLRNINDGLSSLFSVVEHSGST
ESVWKLGMSEARTKPEPPKYGIVQEFFRNVCGRAPSPTTAAGEESCKKPEPLSPASYHQP
EGVSRILNKKAAKAGGSEEVRPTMLSQVGKDGILRDGDGSLILPSEDAVCDCSAQSLASC
FIRPSRNTIRHSPSKCRLHPSESGWGGEERAAPQ
NT seq 4965 nt   +upstreamnt  +downstreamnt
atggagacgccagcgggagagtcatcggcgcggggctacggccccccgcctgcgcccgcg
cccgccgcggagaggaagaaaagccaccgcgcgccatcaccagcccggcccaaggacgtg
gccggctggtctctggccaaaggccgccgcggcacaggcccgggctccgctacagcctgt
ggcaccgcgtcctcggcgaggcccgacaagaaggggcgcgcggtggctcctggtacccga
ggcacggggcctcgggtggccggggtgcgcacgggggtccgcgccaagggtcgccctcgt
cccggtaccgggccccgcccgccgccgccgccgcccagcctcacggacagtagctccgag
gtgtcggactgcgcgtcggaggaggcgcgccagttgggcctggagctggcgctgagcagc
gacgccgagtctgcggcgggcggcccggcggggacccgcaccgggcagccgccccagcca
gcgcagtcggggcagcagcctccgcggcctcccgcctccccggatgagccgtcggtggcc
gcatcgtcggtgggcagcagccgcttgccactcagcgcctcgctagccttctccgacctc
accgaggagatgctggactgtgggcccggaggcttggtgcgggagctggaagagctgcgt
tccgagaacgactatctcaaggatgagattgaggagctacgggctgagatgctggagatg
cgggatgtctacatggaggaagacgtgtatcagctgcaggagttgcggcagcagctggac
caagccagcaaaacctgtcgcatcctgcagtaccgactgcgtaaggctgagcgccgcagc
ctccgcgctgcccagacaggccaggttgatggggaactcatccgaggtctggaacaggac
gtcaaggtctctaaggacatctccatgcggcttcacaaggagctggaggtggtggagaag
aagcggatgaggctggaggaggagaacgaggggcttcgacagaggctcattgagacagag
ctggccaagcaggtgctacagacggagctggatcgtcccagagagcattccttgaagaaa
agaggaacccggtctctggggaagacagataagaagcctactgcacaggaggatagtgca
gacctgaagtgccagctgcattttgcaaaggaggagtcggccctcatgtgcaagaagctc
accaagttggctaaggagaacgacagcatgaaggaggagctgctcaagtacagatcgctc
tatggggacctggatgcagccctgtcggcagaggagctggcggatgctccgcactcccgt
gagactgagctgaaggtgcacctgaagctggtggaggaggaggccaacctgctgagccgg
cgcatagtggagctggaggtggagaaccgtggcctgcgagccgagatggacgacatgaag
gaccacgggggtggcgggggtcccgaggccaggctggccttctcttctctgggtggtgag
tgcggggagagcctagccgagttgcggcgccacctgcagttcgtggaagaggaggctgag
ctgctgaggcgctcctcagctgagctggaggaccagaacaagttgctgctgaacgagctg
gccaaataccgctcggagcacgagctggacgtgacgctgtcggaggacagctgctccgtg
ctcagcgagccctcgcaggaggagctggcagccgccaagctgcagatcggcgagctcagc
ggcaaggtcaagaagctgcagtatgagaaccgcgtgctcctctccaatctgcagcgctgt
gacctggcctcctgccagagcacacgccccatgctggagacggacgctgaggctggggac
tctgcgcagtgcgtgcctgcccctctgggtgagacgctggagccccacgccgcccggctg
tgcagggcccgtgaagccgaggcgctgcccggcctacgggagcaggccgctttggtcagc
aaggccatcgacgtcctggtggctgatgccaatggcttctcagtcggcctccgcctgtgc
ctggacaatgagtgtgctgacttgcgactgcacgaggcgcctgacaacagcgagggcccc
agggatgccaagctcatccacgccatcctggtgcggctgagtgtgttgcaacaggagctg
aacgccttcacccgcaaggcagatgtggccttggggagctctggcaaggagcagcctgag
cccttccctgctctgcctgccttgggctcccagggccctgctaaggagatcatgctgtcc
aaagaccttggctctgacttccagccacctgacttcagagacctgcttgagtgggagccc
aggatccgagaggccttccgtaccggggacttggagtccaagcctgaccctagtcggaac
ttcaggccctaccgagctgaagataacgattcttatgcctctgagatcaaggatcttcag
ctggtcctggccgaggcccacgacagcctccggggcttgcaagagcagctgtcccaggag
cggcagctccggaaggaggaggctgacagcttcaaccagaaaatggtccagctgaaggaa
gaccagcagagggcgctgctgagacgggagtttgagctgcagagtctgagcctccagcgg
cgactggagcagaagttctggagccaagagaagaacatcctggtgcaggagtcccagcag
ttcaagcacaactttctgctgctcttcatgaagctccggtggttcctgaagcgctggcgg
cagggcaaggttctgcccagcgaagaggatgacttcctggaggtgaacagcatgaaggaa
ctgtacctgctgatggaggaagaggagatgaacgcccagcactcggataacaaggcctgc
acaggggagagctggacccagaacacgcctaatgagtgcatcaagaccctggccgacatg
aaggtcaccctgaaggagctgtgctggctgctccaggacgagcgtcggggtctgactgaa
cttcagcagcagttcgcaaaggccaaggccacctgggagacagagcgtgcagagctcaag
ggccacgcctcgcagatggagctgaaggctgggaagggtgccagtgagaggcccgggcct
gactggaaggctgcactgcagagagagcgggaggagcagcaacacctcctggcagagtcc
tacagcgccgtcatggagctgacgaggcagctgcagctgagcgagcgccactggagccag
gagaagctgcagctggtggagcggctgcagggagaaaagcagcaggtggagcagcaggtg
aaggagctgcagaaccgcctcagtcagttgcagaaggctgccgagccctgggtcctgaag
cactcagacatggagaagcaagacaacagctggaaagaggcacgaagtgagaagacccat
gacaaggagggtgtctctgaagctgagctcgggggaactggcttaaagaggaccaaatca
gtctcctccatgtctgagtttgaaagtttgctcgactgctccccgtaccttgctggcggg
gatgcccggaacaagaagctgcccaacggccctgcttttgcctttgtgagtactgagcca
gtggagcctgagaaagacgccaaggagaaggcggggctttccacccgggactgtagccac
attggtagcttggcctgtcaggaacctgcagggagacagatgcagcgcagctacacggct
ccagacaagacgggaatccgagtctactatagtccgccagtggcccggcgcctgggtgtc
cctgtggtccatgacaaggagggcaagatcctcattgagccaggcttcctcttcactacc
gccaagcccaaggagtcagccgaggctgacgggctggccgagagctcctacagccggtgg
ctttgcaatttctcccggcagcggctggatggaggatccggggccagcacctcgggttcc
ggacctgctttccccgccttgcatgactttgagatgtcgggcaacatgagtgacgacatg
aaggagatcaccaactgcgtgcggcaggccatgcgctccggctctctggagaggaaggta
aagaacacatccagccagacggtaggcgtggccaccgtgggcacccagaccattcggacg
gtcagtgtaggtcttcagaccgacccaccccgcagcagcctccacagcaagagctggtca
ccccgcagctcctcgcttgtgtctgtgcgcagcaagcagatctcttcctccctggacaag
gtccattctcgcattgagcggccatgttgctcgcccaagtacggctcacccaagctccag
agacgatcggtgtccaagctggatagcaccaaggaccgcagcctgtggaacctgcaccag
ggcaagcaaaatggctccgcctgggctcgctccaccaccacacgggatagccctgtactg
aggaacatcaatgatgggctttctagcctctttagtgtggtggagcactctgggagcacc
gagtctgtgtggaaactgggcatgtctgaggcccgaaccaaacctgagcctcccaagtat
ggcattgttcaggagttcttccggaacgtgtgtggccgggcaccgagccccactactgca
gcaggcgaggaaagctgcaagaaaccagagcccctttcgccagccagctaccatcaaccc
gagggtgtatccaggatcctgaacaagaaggcggccaaggcaggtggtagcgaagaggtc
agacccaccatgctgtcccaggtggggaaggatggcatccttcgggatggagatggatcc
ttgatccttcccagtgaggatgccgtatgtgactgtagcgcccagtcacttgcctcctgc
ttcatccggccatcccgcaacaccatccggcactctccttccaagtgcaggctgcaccct
tcagagtcaggctggggcggggaggagagggcagctccccagtga

DBGET integrated database retrieval system