KEGG   Mus musculus (mouse): 320709
Entry
320709            CDS       T01002                                 

Gene name
Tmem117, B930062P21Rik
Definition
(RefSeq) transmembrane protein 117
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: TMEM117 BCHF
Other DBs
NCBI-GeneID: 320709
NCBI-ProteinID: NP_848904
MGI: 2444580
Ensembl: ENSMUSG00000063296
UniProt: Q8BH18
Position
15; 15 E3
AA seq 514 aa
MGKDFRYYFQHPWSRMIVAYLVIFFNFLIFAEDPVSHSQTEANVIVVGNCFSFVTNKYPR
GVGWRILKVLLWLLAILIGLIAGKFLFHQRLFGQLLRLKMFREDHGSWMTMFFSTILFLF
IFSHIYNTILLMDGNMGAYLITDYMGIRNESFMKLAAVGTWMGDFVTAWMVTDMMLQDKP
YPDWGKSARAFWKKGNVRIILFWTVLFTLTSVVVLVITTDWISWDKLNRGFLPSDEVSRA
FLASFILVFDLLIVMQDWEFPHFMGDVDVNLPGLHTPHMQFKIPFFQKIFKEEYRIHITG
KWFNYGIIFLVLILDLNMWKNQIFYKPHEYGQYIGPGQKIYTVKDSESLKDLNRTKLSWE
WRSNHTNPQTNKTYVEGDMFLHSRFIGASLDVKCLAFVPSLIAFVWFGFFIWFFGRFLKN
EQGMENQDKTYTRMKRKSPSEHSKDMGITRENTQVSVEDPLNDPALVCIRSDFNEIVYKS
SHLTSENLSLHLKESTSEVEAEQEPAASQRMRTN
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgggtaaagacttccgctactatttccagcatccttggtctcgcatgatcgtggcttac
ctggtcatcttctttaacttcttgatattcgctgaggacccagtctctcacagccaaaca
gaagctaatgttattgttgttggaaactgtttttcatttgtaacaaataaataccctaga
ggagttggctggaggattttgaaggtgcttctatggctactggccattctcataggactg
attgctggcaagttcctcttccatcagcgtttatttggccagttgctccggttaaaaatg
ttccgggaagaccatgggtcgtggatgacgatgttcttcagcacaattctctttctcttc
atcttctctcacatctataacaccatccttctgatggacgggaacatgggagcttatctc
atcactgactatatgggcatccgcaatgaaagtttcatgaaactagctgctgtggggacc
tggatgggggactttgtcacagcttggatggtaactgatatgatgcttcaagacaagccc
taccctgactgggggaaatccgcaagagctttctggaagaaaggcaacgtgaggatcatt
ttattctggaccgtcctcttcaccctgacttccgtggtggtgcttgtcatcacgaccgac
tggatcagctgggacaaactgaaccgtgggtttttgcccagtgatgaggtctcccgagcc
tttcttgcttctttcatcttggtctttgacctccttattgtgatgcaggactgggaattc
ccacacttcatgggcgacgttgatgtgaatctccccgggttgcacacgcctcacatgcag
ttcaagattcccttcttccagaagatcttcaaggaggaataccgcattcacataacaggt
aaatggtttaactacggaattatctttctcgtcttgattttggacctgaatatgtggaag
aaccagatattttacaaacctcatgaatatggacagtatattggcccagggcagaagata
tacacagtgaaagactctgaaagtttaaaggatttaaatagaaccaagctatcctgggaa
tggcggtccaatcacactaatcctcagactaataaaacctacgttgaaggtgacatgttc
ttacacagcaggttcataggggctagcctagatgtcaagtgtctggcttttgttccaagt
ttgatagcttttgtgtggtttggattcttcatttggttctttggacggtttctgaaaaat
gagcaagggatggagaatcaagataaaacttatactcgcatgaaaaggaaatccccctcg
gaacacagcaaagatatgggaatcacccgagaaaacacccaggtctctgtggaagatcct
ctgaatgaccctgccttggtttgtatcaggtctgactttaacgagatagtctacaagtcc
tcccatctgacttcagaaaacttgagcttacatctgaaggaatctaccagtgaggtggag
gctgagcaagagccggcagcctctcaaaggatgaggacgaactag

DBGET integrated database retrieval system