KEGG   Mus musculus (mouse): 320712
Entry
320712            CDS       T01002                                 

Gene name
Abi3bp, 5033411B22Rik, AI506287, BG172926, D930038M13Rik, TA, TARSH, er, eratin
Definition
(RefSeq) ABI family member 3 binding protein
  KO
K24477  target of Nesh-SH3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    320712 (Abi3bp)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   320712 (Abi3bp)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind
Other DBs
NCBI-GeneID: 320712
NCBI-ProteinID: NP_001014421
MGI: 2444583
Ensembl: ENSMUSG00000035258
UniProt: Q59IW8 E9Q8E3
Position
16; 16 C1.1
AA seq 909 aa
MLSSLGCLLLCGSIALALGNAQKLPKGKKPSLKVHINTTSDSILLKFLRPNANVKLEGFL
LGYGSNVSPNQYFPLPTEGKFTEAVVDAEPKYLIVVRPAPPPSQKKSCSGKSRPRKPLQL
VVGTLTPSSVFLSWGFLINPHHDWTLPSHCPSDRFYTIRYREKDKEKKWIFQLCPATETI
VENLKPNTVYEFGVKDNIEGGIWSKIFNHKTIVGSKNKVNGKIQSTYDQVHSVPVPRKLI
PLTIIKQVIQNVTHRASTKSPDKTPFGGTILVHLIIPGLNESTVKLPTSIMLEISDALKA
QLAKNETLALPAESKTPEVEKLAGQPVTVTPESVSRSTKPTLSSALDTAETALAPRQTTS
MPPKLKTPHSRMPAKEPVPKEPLHTTSKPKMPPSPEVADTTSAPLETRGIPLIPVISPRP
SQEELQTAMEETDQSTQELFTTKIPRTTELAKTTQAPHRLHTAPVRPRIPGRPHGRPALN
KTTTRPDKTKPRGTSHKNGVGTGTKQAPKPPSPGRNASVDSHATRKPGSVSGTRRPPIPH
RHSSTRPVSPERRPLPPNNVTGKPGRAGIVSSSRVTSPPLKATLHPIGTATARPGAEQKE
PTAPASEEEFGTTTDFSSSPTKETDPLGKPRFIGPHVRYIPKPENKPCSITDSVRRFPTE
EATEGNATSPPQNPPTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNK
SIQITNQTFSTVENLKPDTSYEFQVKPKNPLGEGPASNTVAFSTESADPRVSEPISAGRD
AIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQR
GHGEDHCQFVDSFLDGRTGQQLTSEQLPTKEGYFRAVRQEPVQFGEIGGHTQINYVQWYE
CGTTIPGKW
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgctctccagcctggggtgtctacttctctgtggaagtattgcacttgctctgggaaat
gcacagaaattgccaaaaggtaaaaagccaagcttgaaagtgcacatcaataccaccagc
gactccatcctcttgaagttcctgcgtccaaatgcaaacgtaaagctggaaggttttctc
ctgggatatggcagcaatgtgtctccaaaccagtacttccctcttcccacagaagggaaa
ttcacagaggctgtagttgatgcagagccgaagtatctgatagtcgtacgacctgctcct
cctcccagccagaagaagtcatgttcagggaaatctcgccctcgcaaacccctccagctg
gtggtgggtacgttgacaccgagttctgtcttcctgtcctggggattcctcatcaaccca
caccatgactggacattgccaagccactgtcccagtgacagattttatacaattcgatat
agagaaaaagataaagaaaagaaatggatttttcaactctgcccagctactgaaacaatt
gtggaaaatctaaagcccaacacagtttatgaatttggtgtgaaagacaatatagaaggt
ggaatttggagtaagattttcaatcataagactattgttggaagtaaaaacaaagtaaac
gggaaaatccaaagcacttatgaccaggtccactcagtgccagtcccgaggaagctaatc
ccactaacgatcattaagcaagtgattcagaatgttactcacagggcttcaaccaaatcc
ccagacaagactccttttgggggaacaatattagttcatctgattattccgggtcttaat
gaatccactgtaaaacttcccacatccataatgcttgagatttccgatgctctcaaggca
caattagctaagaatgaaacattggctttaccagcagaatctaaaacaccagaggtcgaa
aaattggcagggcagccagtaacagtgactccggaatcagtttcaagaagcactaagccc
accctgtctagtgctttagacactgcagagacagcactggcacccaggcagacaaccagc
atgcctcccaagctcaaaacaccacactcaaggatgccagcaaaagagccagttcctaag
gaacccctgcatacgacttcaaagccaaaaatgccaccaagtcctgaagtggcagacact
acatctgcacctttagagacacggggcattcctctcatacctgtgatttcaccaagacct
agtcaagaggaactacaaaccgccatggaagaaacagaccagtctacccaagagctcttc
acgactaagattccacgaacaactgaattggcaaagacaactcaggcaccacacagattg
catacagctcctgtgaggcccagaatacctggcaggccacatggcaggcctgctctgaac
aaaacaactacaaggcctgataaaaccaaacccagagggacgtcccataaaaacggagta
ggaacaggaaccaagcaagcacctaagccaccaagtcctgggagaaatgcgtcagtggat
tcacatgccacaagaaaaccaggctcagtctcagggacgcgtcgtccacccataccacat
aggcattcgtccactagacctgtgtctccagagagaaggcctttacccccgaataatgtc
accgggaagccaggacgtgcgggaattgtttcctccagccgggtaacgtccccacccctg
aaggcaacactccaccctatcggaacagccacagcgagaccaggggcagaacaaaaggaa
ccaactgctcctgcttcagaagaagagtttggtactacaactgacttcagttcaagtccc
accaaagaaactgatccccttgggaagcccaggttcataggtccccatgtgcgatatatc
ccaaagcctgaaaacaagccctgttccatcactgactcagtcagacggttccctacagag
gaagccacggaggggaatgccaccagcccaccacagaacccacccaccaacctcactgtg
gtcactgtcgaaggctgcccctcatttgtcatcttggactgggaaaaacctctaaatgac
actgtcactgaatatgaagtcatatccagagaaaatgggtcattcagtgggaagaacaag
tccattcaaattaccaatcaaacgttctctacagtagaaaacctgaaaccagatacaagc
tatgaattccaggtgaaacccaaaaatccacttggtgagggccccgccagcaacacggta
gcgttcagtactgaatcagctgacccaagagtgagtgagccaatttctgcaggaagagat
gccatctggactgaaagaccttttaactcagactcttactcagaatgcaaaggcaaacag
tatgttaaaaggacgtggtataaaaaatttgtcggagtgcagctatgtaactctctcaga
tacaagatttatttgagcgattccctcacaggcaagttttacaacataggagatcagagg
ggccacggagaagatcactgccagtttgtggattcatttttagatggtcgcacaggacag
caactcacctctgaacagttacccaccaaagaaggctatttcagagctgttcgtcaggaa
cctgtccaatttggagaaataggtggtcatacccaaatcaattatgtccagtggtatgaa
tgtgggaccacaatacctggaaaatggtag

DBGET integrated database retrieval system