KEGG   Mus musculus (mouse): 320817Help
Entry
320817            CDS       T01002                                 

Gene name
Atad2b, 1110014E10Rik, BC032887, C79189, D530031C13Rik
Definition
(RefSeq) ATPase family, AAA domain containing 2B
  KO
K22531  ATPase family AAA domain-containing protein 2 [EC:3.6.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    320817 (Atad2b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     320817 (Atad2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Bromodomain AAA_lid_3 AAA_16 IstB_IS21 AAA_2 AAA_22 AAA_5 DUF2075 RuvB_N AAA_7 RNA_helicase AAA_18 ResIII Mg_chelatase TIP49 AAA_11
Motif
Other DBs
NCBI-GeneID: 320817
NCBI-ProteinID: NP_001349278
MGI: 2444798
Ensembl: ENSMUSG00000052812
Position
12; 12 A1.1
AA seq 1457 aa AA seqDB search
MVNTRKSSLRLLGSKSPGPGPGPGAGAGAEPGATGGSSHFISSRTRSSKTRAASCPAAKA
GGSGGALDEARKAEVDGSLSDSHVSPPAKRTLKQPDSVCKDKSKSRSTGQREEWNIPSGQ
TRLTSQPGATLPNGHSSLSLRSHPLRGEKKGDGDLSCINGDIEVRKSCRSRKNRFESVNQ
SLLFDQLVNSTAEAVLQEMDNINIRRNRRSGEVERLRMWTDTEFENMDMYSRVKRRRKSL
RRNSYGIQNHHEVSTEGEEEESQEEDGDIEVEEAEGEENDRPYNLRQRKTVDRYQAPPIV
PAHQKKRENTLFDIHRSPARRSHIRRKKHAIHSSDTTSSDEERFERRKSKSMARARNRCL
PMNFRAEDLASGILRERVKVGASLADVDPMNIDKSVRFDSIGGLSHHIHALKEMVVFPLL
YPEIFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKKVAFFMRKGADCLSKWVG
ESERQLRLLFDQAYLMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDNRGE
IVVIGATNRLDSIDPALRRPGRFDREFLFNLPDQRARKHILQIHTRDWNPKLSDAFLGEL
AEKCVGYCGADIKALCTEAALTALRRRYPQIYASSHKLQLDVTSIVLSAHDFYHAMQNIV
PASQRAVMSSGQALSPIIRPLLERSFNNILAVLQKIFPHAETSQSDKKEDVGSLILDDSE
EENALSIFEMSCHSGSPKKSLPAAAVTKPYLHFTMSPYHQPTSYRPRLLLSGERGSGQTS
HLAPALLHTLERFSVHRLDLPALYSVSAKTPEESCAQIFREARRTVPSIVYMPHIGDWWD
AVSDTVRATFLTLLQDIPSFSPIFLLSTSETMYSELPEEVKCIFRIQYEEVLYIQRPIEE
DRRKFFQELILHQASMAPPRRKHTALRAMEVLPLALPSPPRQLSESEKNRMEDQEENTLR
ELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAK
DFLQDIDLICSNALEYNPDKDPGDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEA
RIKRGLSVTAEQITPHGAGARKTETRVEEAFRHKQRNPMDAWHNSANKCAFRVRRKSRRR
SQWGKGIIKKRKVNNLKKDEEDTKFTDYDHTEDRKLLENGEFEVSTDCHEENGEETGDLS
MTNDESSCDIMDMDQGQRLNSGAGTKENFASTEEESSNESLLVHSSSSLNPEQTSKKEPF
LKGTCLNGEASTDSSEGIPVLECQNGRVLEVVPLPDGGEKSSSEQKIALEEQLKDKPETW
NENRGDAAEKLEVLECSSSEKPEPGPDAEGKETELDREGASKVKKYRKLLLEQAKPTNLE
LVPEEPSEPAPPLVVDHERLQKLLDLLVDKSNNLTVDQLERLYSLLSQSIYRHRKDYDKS
QLVEEMERTVHMFETFL
NT seq 4374 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacacccggaagagctctctgcgccttctcgggtccaagtctcctgggcccggg
cctgggcccggggccggagccggagcggagccgggggcgaccggcggcagcagccatttc
atctcctctcggacccgctcctctaagacgcgcgcggccagctgcccggcggccaaggcc
gggggaagcggcggcgccctggacgaggcccggaaggctgaagttgacggaagcttaagt
gatagccacgtatctcctccagccaaacgcactttgaaacagccggattctgtttgcaaa
gacaaatcaaaatcacgaagtactggtcagcgagaagaatggaacataccatctggtcag
accaggttaacttctcagcctggtgctacattaccaaacggacatagtagcttgtcactt
cgaagccacccccttcgaggggaaaagaaaggagatggcgacctttcatgtataaatggt
gacatagaagtcagaaaaagttgtcggtccaggaaaaacagatttgaaagtgtgaatcag
agtttattatttgatcagctagtaaatagtactgctgaagctgtattacaagaaatggat
aatattaatatccgacgaaaccgtcgatcaggcgaagtagagaggcttcgaatgtggaca
gatacagaatttgaaaatatggatatgtattcaagggtaaaaagacgaagaaaatcactg
agaagaaatagttatgggatacagaatcatcatgaggtttccactgagggcgaggaagaa
gaatctcaagaggaggatggagacatagaggttgaagaggcagaaggagaagaaaatgat
agaccatataacttgagacaaagaaaaacagtggatcgataccaagcaccgcctatagta
ccggctcatcaaaaaaagagggaaaatacactatttgatattcacaggtctccagcaaga
agaagccatatcaggagaaagaaacatgccattcacagtagtgatacaacttcttctgat
gaggaacgctttgaaagaaggaaatcgaaaagcatggcaagagcaagaaacagatgtttg
ccgatgaacttcagagcagaagatttagctagcggcatcctccgagaacgggtgaaagtg
ggtgcaagtttggctgatgttgatcccatgaacattgataaatcagtgcggtttgatagc
ataggtggattgagccatcatattcacgctttgaaggagatggtagtttttccactttta
tatccagaaatttttgaaaaatttaaaattcagcctccaaggggctgtttgttttatggt
cctcctggcacaggtaaaaccttggttgctagagctttagctaatgaatgcagtcaagga
gacaaaaaggtagcatttttcatgcgaaaaggagcagactgtttgagcaagtgggtcggg
gagtcagaaaggcagctgaggctgctctttgatcaggcatatttgatgaggccttctata
atattttttgatgaaatagatggcttagctcctgttcgttctagtagacaagatcagatc
cacagctctatagtgtcaaccctccttgcccttatggatggattagataatagaggtgaa
attgttgttattggtgctacaaacagacttgactctattgatcctgcactcaggagacct
ggtcgttttgacagagaatttcttttcaacctgcctgatcaaagggccagaaagcacatc
ttgcagatccacaccagggactggaacccaaaactgtctgatgcatttttaggagaattg
gcagaaaaatgtgttggctactgtggagctgacatcaaggccctgtgtacagaagccgcc
ctgactgccctgcggaggcgctaccctcagatctatgccagcagccacaagctgcagctg
gatgtcacctcaatagtgctcagcgcccacgacttctaccatgccatgcagaacatcgtg
cctgcttcccaacgtgctgtgatgtcttcaggacaggcgctgtcccccattataaggcca
ttgctagaaagaagtttcaacaacatcttagcagtcctgcaaaaaatatttcctcatgca
gaaactagccagagtgacaagaaagaagatgtaggaagtctgattttagatgatagtgaa
gaggagaatgctttatcaattttcgagatgagttgtcactcgggatcaccaaagaagtca
ttgccagctgctgctgtcactaaaccttatctccactttacaatgtcaccgtatcatcag
ccaacctcttataggcctcgattgttgctatctggagaacgaggttcaggacaaacttcg
caccttgctccagcacttttgcatacactagaaagattctctgtgcatcggctcgatctc
ccagcactttactcagtcagtgccaaaacacctgaagaatcatgtgcacagatatttcga
gaagctcgaagaacagtaccgagtattgtttacatgcctcatattggtgactggtgggat
gctgtcagtgacactgtgagagcaactttcttgacattgctgcaggatataccgtctttt
tcacctatatttttattgtctacctctgaaaccatgtacagtgaactgcctgaagaggtt
aaatgtatctttagaatacagtatgaagaggtattatatattcaaagacctattgaagaa
gatcgaagaaaatttttccaagaacttattctccatcaggcgtcaatggcaccaccacga
aggaaacatactgctcttcgtgctatggaagtgcttccgcttgcactaccatcacctcct
cgtcagttatcagaatcagaaaaaaatcggatggaagaccaggaggaaaatacgttacga
gagttgcggttgttcctcagggacgttaccaagaggctggccacagataaacgctttaac
atcttcagcaaaccggtggatattgaagaggtttcagattaccttgaagtaatcaaagaa
ccaatggatttatcgacagtaataactaaaattgataaacataattatctaacggctaaa
gatttcctgcaagatattgacctcatctgtagcaatgctttagaatacaacccagacaag
gaccccggagataaaattattaggcacagagcttgtaccctgaaggacactgcacatgcc
atcattgcagctgagctggatcctgagtttaataagctctgtgaagaaataaaggaagca
agaataaagagaggcctatcagtaacagcagaacaaataactcctcatggtgctggtgcc
cgcaagacagagactagagtggaagaggcgtttcgacacaaacagagaaacccaatggat
gcctggcacaactctgcaaataaatgtgcatttcgagtccggagaaaatcaaggcggcga
tcacagtggggtaaaggaattattaagaaaaggaaagtcaataatttaaagaaagatgag
gaagacaccaagtttacagactatgaccatacagaggacaggaagttgctggagaatgga
gagtttgaggtaagcactgattgccatgaggaaaatggagaagagactggagacttatct
atgaccaacgatgaatcttcatgtgacatcatggatatggaccagggtcagaggctgaat
agtggagcgggcaccaaagagaactttgcatcaacagaagaggagagttcaaatgaatct
ctgctcgtccacagtagcagttccctcaaccccgagcagacatctaagaaagagcccttc
cttaaaggcacctgtctaaatggtgaggcttccactgacagctctgaaggaattcctgtt
ctggagtgtcagaatggcagagttcttgaagtagttcctctgcctgatggtggagaaaag
tctagttctgaacaaaagattgctctggaggaacaactaaaagacaaaccagaaacatgg
aatgaaaatcgtggagatgctgctgagaagctagaagtgctggaatgtagcagtagtgag
aagcccgagcctggccctgatgcagaggggaaagagacagagctggatagagaaggtgct
tctaaagttaaaaaatatcgtaaattattgttagagcaggcaaaaccaacaaacctcgaa
ctggttccagaagagccatccgagcctgcgccgcctttggtagttgatcacgagagactg
cagaaattgcttgatttgttggtagataaaagcaacaacctgacagtcgatcagcttgag
agattatattccctccttagtcagagcatctaccgccatcgtaaagattatgacaaatct
cagcttgtggaggagatggaaaggacagttcatatgtttgagacattcctatga

DBGET integrated database retrieval system