KEGG   Mus musculus (mouse): 320832Help
Entry
320832            CDS       T01002                                 

Gene name
Sirpb1a, 9930027N05Rik, SIRP-beta, Sirpb, Sirpb1
Definition
(RefSeq) signal-regulatory protein beta 1A
  KO
K06551  signal-regulatory protein alpha/beta1/gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    320832 (Sirpb1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    320832 (Sirpb1a)
   04090 CD molecules [BR:mmu04090]
    320832 (Sirpb1a)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  SIRP family
   320832 (Sirpb1a)
CD molecules [BR:mmu04090]
 Proteins
  320832 (Sirpb1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 V-set C2-set_2 ig Ig_2 I-set
Motif
Other DBs
NCBI-GeneID: 320832
NCBI-ProteinID: NP_001002898
MGI: 2444824
Ensembl: ENSMUSG00000095788
Vega: OTTMUSG00000052297
UniProt: Q6F5F2
Position
3; 3 A1
AA seq 391 aa AA seqDB search
MLLLDAWTHIPHSVLLLILLLGFKGAAVRELKVIQPVKSFFVGAGGSATLNCTVTSLLPV
GPIRWYRGVGQSRLLIYPFTGEHSPRITNVSDVTKRNNMDFSIRISNVTPADSGTYYCVK
FQRGSSEPDIEIQSGGGTELLVLAKPSSPMVSGPAARAVPQQTVTFTCRSHGFFPRNLTL
KWFKNGDEISHLETSVEPEETSVSYRVSSTVQVVLEPRDVRSQIICEVDHVTLDRAPLRG
IAHISEFIQVPPTLEIRQQPTMVWNVINVTCQIQKFYPPSFQLTWLENGNISRREVPFTL
IVNKDGTYNWISCLLVNISALEENMVVTCKVEHDEQAEVIETHTVLVTEHQRVKELKTAG
IAKIPVAVLLGSKILLLIAATVIYMHKKQNA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcttctcctagatgcctggacccacattcctcacagtgtcctgctgttgatcctgctt
ctgggatttaaaggagcagctgtgagagagctgaaagtgatccaacctgttaaatcattt
tttgttggtgctggagggtcagccactctaaactgcacagtgacatccctcctccctgtg
gggcccataaggtggtataggggtgtaggacaaagtcgactcttgatatacccgttcaca
ggagaacattccccccgaataacaaatgtttcagatgttacaaagagaaacaacatggac
ttttccatccgtatcagtaatgtcactcctgctgattcgggtacctactactgtgtgaag
ttccagagaggatcatcagagcctgacattgagattcagtctggaggtggcactgagttg
ttagtccttgctaaaccatcttcacctatggtctccggtcctgcagccagagctgtccct
cagcagacagtgacctttacatgcagatcccatggattctttccgcggaacctcacgctg
aagtggttcaagaatggagatgagatctctcacttggaaacttctgtggaaccggaagaa
acaagtgtctcctatagagtttccagcacagtccaggtggtgttggaacctagggatgtc
cgctctcagatcatctgtgaagtggatcatgtcactttagatcgagcccctctcagaggg
attgctcacatctctgagttcattcaagttccacccaccctggagatccgccagcagcca
acaatggtttggaatgtgataaatgtcacctgccaaatacagaagttctatcctccaagt
tttcagttgacctggttagagaatggaaatatatcccggagagaagtaccttttacactt
atagtaaacaaggatggaacttacaactggatcagctgtctcttggtgaacatatctgcc
cttgaggagaacatggtagtgacatgcaaggttgagcatgatgaacaagcagaagtcatt
gaaacccatactgtgctggtcactgaacatcagagagtgaaagaactgaagacggcaggt
attgctaaaatacctgtagctgtgctccttggatccaaaatactgctgttaattgctgcc
actgtcatttacatgcataagaagcaaaatgcctga

DBGET integrated database retrieval system