KEGG   Mus musculus (mouse): 320844Help
Entry
320844            CDS       T01002                                 

Gene name
Amigo3, E430002N15Rik, ali3, mKIAA1851
Definition
(RefSeq) adhesion molecule with Ig like domain 3
  KO
K22529  amphoterin-induced protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    320844 (Amigo3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 Ig_3 LRR_9 I-set ig Prominin DUF3726 LRR_5 V-set
Motif
Other DBs
NCBI-GeneID: 320844
NCBI-ProteinID: NP_796249
MGI: 2444854
Ensembl: ENSMUSG00000032593
Vega: OTTMUSG00000016524
UniProt: Q8C2S7
Position
9; 9 F1
AA seq 508 aa AA seqDB search
MAWLVLSGILLCMLGAGLGTSDLEDVLPPAPHNCPDICICAADVLSCAGRGLQDLPVALP
TTAAELDLSHNALKRLHPGWLAPLSRLRALHLGYNKLEVLGHGAFTNASGLRTLDLSSNM
LRMLHTHDLDGLEELEKLLLFNNSLMHLDLDAFQGLRMLSHLYLSCNELSSFSFNHLHGL
GLTRLRTLDLSSNWLKHISIPELAALPTYLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLS
ALHDFEREYTCLVFKVSESRVRFFEHSRVFKNCSVAAAPGLELPEEQLHAQVGQSLRLFC
NTSVPATRVAWVSPKNELLVAPASQDGSIAVLADGSLAIGRVQEQHAGVFVCLASGPRLH
HNQTLEYNVSVQKARPEPETFNTGFTTLLGCIVGLVLVLLYLFAPPCRGCCHCCQRACRN
RCWPRASSPLQELSAQSSMLSTTPPDAPSRKASVHKHVVFLEPGKKGLNGRVQLAVAEDF
DLCNPMGLQLKAGSESASSTGSEGLVMS
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcctggctagtgctatcaggtatactactatgcatgttgggtgctggattgggcact
tcagacttggaggatgttctgcctcctgctccccacaactgccccgatatatgcatctgt
gctgccgatgtgttgagctgtgcgggccgtgggttacaggacttgccggtagcactgcct
accactgctgcagaactcgatttgagccacaacgcactcaaacgcctgcacccggggtgg
ttagcgcccctctcccggctgcgtgccttgcacctaggctataataagctggaagtcctg
ggccatggtgcgttcaccaatgccagtggcctgaggacacttgacctgtcctctaatatg
ttaaggatgctccatacccatgacctggatggcctggaggagctggagaagttacttctg
ttcaataacagcctgatgcacttggacctggatgccttccagggcctgcgcatgcttagc
cacctctatctcagctgcaacgagctctcctctttctctttcaaccacttgcacggtctg
gggttaacccgcctgcggactctggacctctcctccaactggctgaaacatatctccatc
cctgagttggctgcactgccaacttatctcaagaacaggctctacctgcacaacaacccg
ctgccctgtgactgcagcctctaccacctgctccggcgctggcaccagcggggcctgagt
gccctgcatgattttgaacgcgagtacacatgcttggtctttaaggtgtcagagtcccga
gtgcgcttttttgagcacagccgggtcttcaagaactgctctgtggctgcagctccaggc
ttagagctgcctgaagagcagctgcacgcgcaggtgggccagtccctgaggctcttctgc
aacaccagtgtgcctgccactcgggtggcctgggtctccccgaagaatgagctgcttgtg
gcgccagcctctcaggatggtagcatcgctgtgttggctgatggcagcttagccataggc
agggtgcaagagcagcacgcaggcgtctttgtgtgcctggccagtgggccccgcctgcac
cacaaccagacacttgagtacaatgtgagtgtgcaaaaggctcgccccgagccagagact
ttcaacacaggctttaccaccctgctgggctgtattgtgggcctggtgctggtgttgctc
tacttgtttgcaccaccctgtcgtggctgctgtcactgctgtcagcgggcctgccgcaac
cgttgctggccccgggcatccagtccactccaggagctgagcgcacagtcctccatgctt
agcactacgccaccagatgcacccagccgcaaggccagtgtccacaagcatgtggtcttc
ctggagccgggcaagaagggcctcaatggccgtgtgcagctcgcagtagctgaagacttc
gatctgtgcaaccccatgggcttgcaactcaaggctggctctgaatcagccagttccacg
ggctcagagggtctcgtgatgagctag

DBGET integrated database retrieval system