KEGG   Mus musculus (mouse): 320865
Entry
320865            CDS       T01002                                 

Symbol
Cdh18, B230220E17Rik, Cdh14l, Tg(GFAP-APOE_i4)1Hol
Name
(RefSeq) cadherin 18
  KO
K06805  cadherin 18, type 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    320865 (Cdh18)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Major cadherins
   320865 (Cdh18)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Cadherin_3 Cadherin_2 ASFV_J13L
Other DBs
NCBI-GeneID: 320865
NCBI-ProteinID: NP_001074768
MGI: 1344366
Ensembl: ENSMUSG00000040420
Vega: OTTMUSG00000036412
UniProt: E9Q9Q6
Position
15:22548984..23477577
AA seq 790 aa
MRITSTSCICPVLVCLCFVQRCYGTAHHSSIKVTRNQTKHTEGETEVHHRPKRGWVWNQF
FVLEEHMGPDPQYVGKLHSNSDKGDGSVKYILTGEGAGTIFIIDDTTGDIHSTKSLDREQ
KTHYVLHAQAIDRRTNKPLEPESEFIIKVQDINDNAPKFTDGPYIVTVPEMSDMGTSVLQ
VTATDADDPTYGNSARVVYSILQGQPYFSVDPKTGVIRTALHNMDREAREHYSVVIQAKD
MAGQVGGLSGSTTVNITLTDVNDNPPRFPQKHYQLYVPESAQVGSAVGKIKANDADTGSN
ADMTYSITNGDGIGVFSISTDKDTREGILSLKKPLNYEKKKSYTLNIEGANTHLDFRFSH
LGPFKDATMLKVIVGDVDEPPLFSMPSYVMEVYENAKIGTIVGTVLAQDPDSANSLVRYF
INHSTEEERFFNIDANTGTIKTSKVLDREETPWYNITVTASENDNPDLLSHVSVGIRVLD
VNDNPPELAREYDIVVCENSKPGQVIHTITATDKDDFANGPRFHFFLDERLPMNPNFTLK
DNEDNTASILTRRRRFSRTMQDVYYLPIMISDGGIPSLSSSSTLTIRVCACERDGRVRTC
HAEAFLSSAGLSTGALIAILLCVVILLAIVVLFITLRRGKKEPLIISEEDVRENVVTYDD
EGGGEEDTEAFDITALRNPAAAEEFTYRRDIRPEVKLTPRHQTLSTLESIDVQEFIKQRL
AEADLDPSVPPYDSLQTYAYEGQRSEAGSISSLDSATTQSDQDYHYLGDWGPEFKKLAEL
YGEIESERTT
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgagaattacgagcacatcttgcatctgtccagtcctcgtgtgtctctgttttgtgcag
aggtgttatggaactgctcaccacagctccattaaggtgaccagaaaccaaaccaaacac
actgaaggggaaactgaagtacaccatcgtcccaagaggggatgggtatggaaccagttc
tttgttttagaagaacatatgggaccagacccacagtatgttggaaaactgcactccaac
tccgacaaaggtgatggttctgtcaagtacatcctgactggagaaggggccgggactata
tttatcattgatgacaccacaggtgacatccactcaaccaaaagcctggacagagagcag
aagactcactatgtgctccatgcccaggctattgacagacggacaaacaagcctcttgaa
cctgagtctgagttcatcatcaaagtgcaagatattaatgacaatgccccaaagttcaca
gatggaccatacatcgttactgtgcctgaaatgtcagatatgggtacctctgttctgcag
gtgacagctacagatgcagatgaccccacctatgggaacagtgctcgagttgtttacagt
atcctgcaaggacaaccttatttctctgtagatcctaaaacaggagtcattcgaacagct
ttacacaacatggatagagaagccagagagcattactcagtggtcattcaagccaaagac
atggctgggcaagttggcggactttctggatccaccactgtcaatattaccttgactgat
gtcaatgacaacccaccacggttcccacagaaacactatcaactgtatgttcctgagtct
gctcaagttggttcagctgttgggaaaatcaaagcaaatgatgcagacacaggatcaaat
gcagatatgacctactccatcactaatggagacgggattggagtgttctctatctccacg
gacaaggacaccagagaaggaatactttccttaaaaaagccactgaactatgagaaaaag
aagtcttacacactcaacattgaaggagcaaacacacatctggatttccgtttttcccac
ttgggtccatttaaggatgccaccatgctgaaggttattgttggggatgtggatgagcca
ccactcttttctatgccttcctatgtcatggaagtctatgaaaatgccaagattgggaca
attgttggcactgtcttggctcaggatccagacagtgctaacagcttagtaaggtatttc
atcaatcacagtactgaagaggagagatttttcaatattgatgccaatactggaaccatt
aagacatcaaaagtactggatagagaagaaacaccatggtacaatatcacagtgactgct
tcagaaaacgacaatcctgatttgctgagccatgtctccgtgggtattagagttctggat
gtcaatgacaatccacctgaacttgccagggaatatgatattgttgtctgtgagaattct
aagcctggtcaggttatccacaccatcactgccactgataaagatgactttgccaatgga
ccgagatttcatttttttcttgatgagcgcctgcccatgaacccaaatttcacacttaag
gacaatgaagataacacagccagcattctgacaaggcggaggagatttagtcgaactatg
caggatgtgtattatctgcccattatgatctctgacggtggaatcccctctctcagcagc
agcagcaccctcaccatcagggtttgtgcatgcgagagagatgggcgcgtgcggacctgc
catgcagaagccttcctgtcctccgctggtttgagcacaggagccctaatcgctattctt
ctctgtgttgtcattcttcttgccattgtggtcctttttatcaccttgaggcgtggcaaa
aaagagcccttgatcatttccgaggaggatgtgcgagagaatgtggtgacatatgatgac
gagggaggaggggaggaagacaccgaagccttcgacatcacagctttgcggaatcctgcc
gcagcagaggagttcacgtaccgcagagacattcggcctgaagtgaagctcactccgaga
catcagaccttgtccaccctggagagcatagacgttcaggagtttattaagcaaagactc
gcagaagccgacctggaccccagcgtgcccccttatgactctcttcagacttatgcctac
gagggccagcggtcagaagctgggtctatcagctcactggactccgcaaccacgcaatca
gaccaggattatcactaccttggagactgggggcccgagtttaagaagttagctgaactc
tatggagaaatagaatctgaaagaacaacttag

DBGET integrated database retrieval system