KEGG   Mus musculus (mouse): 320982Help
Entry
320982            CDS       T01002                                 

Gene name
Arl4c, A630084M22Rik, Arl7, LAK
Definition
(RefSeq) ADP-ribosylation factor-like 4C
  KO
K07945  ADP-ribosylation factor-like protein 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    320982 (Arl4c)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl4/Arl7
    320982 (Arl4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc Ras SRPRB G-alpha MMR_HSR1 GTP_EFTU Gtr1_RagA 6PF2K
Motif
Other DBs
NCBI-GeneID: 320982
NCBI-ProteinID: NP_796279
MGI: 2445172
Ensembl: ENSMUSG00000049866
Vega: OTTMUSG00000028785
UniProt: P61208
Position
1; 1 D
AA seq 192 aa AA seqDB search
MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAK
GISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGT
PLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMIL
KRRKSLKQKKKR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacatctcctccaacatctcggccttccagtctctgcacatcgttatgctgggc
ttggactcggccggcaagactacggtgctctaccggctcaagttcaacgaattcgtgaac
actgtgcccactatcggcttcaacaccgagaagatcaaactgagcaacggcactgccaag
ggcatcagctgccacttctgggacgtgggcggccaggagaagctacggccgctgtggaag
tcctacagccgctgcacggacggcatcatctacgtggtggattcggtggacgtggaccgg
ctggaggaggccaagacggagctgcacaaggtgaccaagtttgcggagaaccagggcaca
ccgctcctggttatcgccaacaagcaggatctgcctaagtcgctgccggtggccgagatt
gagaagcaactggcgctgcacgagctcatcccggccaccacctaccatgtccagccggcg
tgcgccatcatcggcgagggcctcaccgagggcatggacaagctctatgagatgatcctg
aaacgcaggaagtctctcaagcagaagaagaagcggtaa

DBGET integrated database retrieval system