KEGG   Mus musculus (mouse): 320995
Entry
320995            CDS       T01002                                 

Gene name
Rfx6, 4930572O07Rik, Rfxdc1
Definition
(RefSeq) regulatory factor X, 6
  KO
K19521  regulatory factor X 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    320995 (Rfx6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    320995 (Rfx6)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other basic domains
   RF-X
    320995 (Rfx6)
SSDB
Motif
Pfam: RFX_DNA_binding DUF240 Pox_D5 RXLR
Other DBs
NCBI-GeneID: 320995
NCBI-ProteinID: NP_001152861
MGI: 2445208
Ensembl: ENSMUSG00000019900
UniProt: Q8C7R7
Position
10; 10 B3
AA seq 927 aa
MAKVRELEEAFVQEQPSPQLPSEIAEECCAQLLGKGLLVYPEDSAYLLAETAAGARSSGE
KGGDPGLQVGVKSEMQLNNGNFSSEEEDADTQESKTKAADPQLSQKKSITQMMKDKKKQT
QLTLQWLEDNYIVCEGVCLPRCILYAHYLDFCRKEKLEPACAATFGKTIRQKFPLLTTRR
LGTRGHSKYHYYGIGIKESSAYYHSVYSGKGLTRFSGSKLKNEGGFTRKYSLSSKTGTLL
PEFPSAQHLVYQGCISKDKVDTLIMMYKTHCQCILDNAINGNFEEIQHFLLHFWQGMPDH
LLPLLENPVIIDIFCVCDSILYKVLTDVLIPATMQEMPESLLADIRNFAKNWEQWVVSSL
ENLPEALIDKKIPILRRFVSSLKRQTSFLHLAQIARPALFDQHVVNAMVSDIEKVDLNSI
GSQALLTISNSTDTESDIYSEHDSITVFQELKDLLKKNATVEAFIEWLDTVVEQRVIKMS
KQNGRSLKKRAQDFLLKWSFFGARVMHNLTLNNASSFGSFHLIRMLLDEYILLAMETQFN
NDKEQELQNLLDKYMKNSDASKAAFTASPSSCFLANRNKASSLASDTVKNESHVETSYVP
LPSSQPGAIPPALHPFSTEDTDNMPLPGQIELSQSTGHLMTPPISPAIASRGSVINQGPM
ASRPPSVGTVLSAPTHCSTYAEPIYPTLSPANHDFYGTNSNYQTMFRTQSHPASSLYAHR
AEHGRCMAWTEQQLSRDFFGGSCAGSPYNCRPPSSYGPSTHTQESHSMQVLNTGSFNFLS
NAGAGSCQGSTLPSNSPNGYYGNNINYSEAHRLGSMVNQHVSVISSVRSLPPYSDIHDPL
NILDDSSRKQNNSFYADTLSPVACRTTVVASNLQTQIPSSSSQCMYGTSNQYPVQDSLDS
NAASNREMVSSLPPINTVFMGTAAGDT
NT seq 2784 nt   +upstreamnt  +downstreamnt
atggctaaggtccgggaactggaggaagctttcgtgcaggagcagccttcgccccaactt
ccctccgagatcgcggaggagtgctgcgcgcagctgcttggcaagggcttgctggtctac
cctgaggacagtgcttacctgctggctgaaacagccgcgggcgctcggagcagcggtgag
aaaggcggagatcccgggctgcaggtgggagttaaatcagaaatgcagttaaacaacggc
aacttttcctcggaagaagaggatgcggacacccaggagagcaagaccaaagcagccgac
ccacagctctctcagaagaagagcatcacgcagatgatgaaggataagaagaagcagact
cagctcaccctgcagtggcttgaagacaattacatagtgtgtgaaggagtttgcctccca
cggtgcattctttatgctcactacctagatttctgcaggaaagagaaactggagccagct
tgtgcagccacctttggaaagacaattcgccaaaaatttcccctcctaacaactcgaaga
cttggaacaagaggacattcaaagtaccattactatgggattggcatcaaagaaagcagt
gcatattaccactctgtttattctggaaagggcttgacaaggttttcggggagcaaactg
aagaatgagggtggttttacacgtaaatactcacttagctcaaaaacaggaacacttctt
ccagaatttcccagcgctcaacatcttgtgtaccaaggatgcatttctaaggacaaggtt
gatactctcataatgatgtacaaaactcactgccagtgcatactcgacaatgccatcaat
gggaactttgaagagatccagcatttcttactacacttttggcaaggaatgccagaccat
ctccttcccctgcttgaaaatcctgttatcattgatattttctgtgtctgtgactcaatt
ctttataaggttcttacagatgtcctcattcctgcaacaatgcaagaaatgcctgaaagt
ttgttagcagatataagaaattttgctaaaaattgggaacagtgggttgtttcatccttg
gaaaacttgccagaagccctcattgataagaaaatccccattttgcgaagatttgtatct
tccctgaagcgacagacatctttcttgcatcttgctcagattgccagaccagctctcttt
gaccagcatgtggtgaatgccatggtatctgatattgaaaaggttgacttaaatagtatt
gggtctcaggctcttcttaccatatccaacagcacagacacggaatctgacatctacagt
gaacatgactctattactgtgttccaagaactgaaagatctccttaagaagaatgctaca
gtggaggcatttattgaatggttggacactgtggtagagcagagagttattaagatgagc
aaacaaaatggaagatctctgaagaagagggctcaagactttctgctcaaatggagcttt
tttggtgcccgcgtgatgcataatcttaccttgaacaacgcatcaagttttggctctttc
catctgatccgaatgcttctggatgagtacattctcctggccatggagactcaatttaac
aatgacaaagagcaggaactacagaatttattggacaagtatatgaagaactcggatgcg
agtaaagctgccttcacagcttccccgagctcttgctttctggccaaccgaaataaggct
agctcacttgccagtgacactgtgaagaacgaaagccacgtggagacatcctatgtccct
ctgccttccagccagcctggagccataccccctgctctgcacccattctcaactgaggac
actgataacatgccactcccaggtcaaatagagctttcacaaagtactggccatctgatg
acaccaccgatttctccagccatagcaagcagaggaagtgttattaaccaagggccaatg
gcgagcagacccccgagcgtgggcacagttctctcagctccaacacattgctcaacatat
gcagaaccaatttatcctacgctctctccagccaaccacgacttttatgggaccaactct
aactatcagactatgtttaggacacagtctcaccctgcatcaagcctctatgctcaccgt
gcagagcatgggcggtgcatggcctggactgaacagcagctttctagagacttctttggt
ggcagttgtgctgggtctccatataattgtaggccaccttccagttatggaccatccaca
cacacacaagagtcacacagcatgcaggttttgaacacaggaagcttcaatttccttagt
aatgcaggagctggcagctgccaagggtcaacattgccttctaattctcccaatggatac
tatggaaacaatataaactactcagaggcacataggcttggatcgatggtgaaccaacat
gtttcagtcatcagcagtgtgcgctccctgcctccctacagtgatattcatgatccactt
aacattttagatgacagcagccggaagcagaacaactcgttttatgcagacacattgtct
cctgttgcatgtcgtactactgtagtagcttccaacttgcaaacccagattccttcatct
tcatcccagtgtatgtatggaacttccaatcagtatccagtgcaagatagtctggactcc
aatgcagcaagcaacagagaaatggtgtcctctttaccacccatcaacaccgtgtttatg
gggacagcagctggagacacttaa

DBGET integrated database retrieval system