KEGG   Mus musculus (mouse): 321019Help
Entry
321019            CDS       T01002                                 

Gene name
Gpr183, Ebi2
Definition
(RefSeq) G protein-coupled receptor 183
  KO
K04305  Epstein-Barr virus induced gene 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    321019 (Gpr183)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   Oxysterol
    321019 (Gpr183)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 321019
NCBI-ProteinID: NP_898852
MGI: 2442034
Ensembl: ENSMUSG00000051212
UniProt: Q3U6B2
Position
14; 14 E5
AA seq 357 aa AA seqDB search
MANNFTTPLATSHGNNCDLYAHHSTARVLMPLHYSLVFIIGLVGNLLALVVIVQNRKKIN
STTLYSMNLVISDILFTTALPTRIAYYALGFDWRIGDALCRVTALVFYINTYAGVNFMTC
LSIDRFFAVVHPLRYNKIKRIEYAKGVCLSVWILVFAQTLPLLLTPMSKEEGDKTTCMEY
PNFEGTASLPWILLGACLLGYVLPITVILLCYSQICCKLFRTAKQNPLTEKSGVNKKALN
TIILIIVVFILCFTPYHVAIIQHMIKMLCSPGALECGARHSFQISLHFTVCLMNFNCCMD
PFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTESQMMIHSKASNGR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggctaacaatttcactaccccactggcaacgtctcatggcaataactgtgatctctat
gcccaccacagcacagccagggtattaatgcctctgcattacagcctggtcttcatcatt
gggctggtgggaaacctgctggccttggttgtcattgttcaaaacagaaaaaaaatcaac
tcaaccactctctattcaatgaacttggtcatttctgacatcctgtttaccacagcttta
cccactcggatagcctactatgcgctgggctttgattggaggataggtgatgccctgtgc
cgggtaactgctctggtgttctacatcaacacgtacgcaggtgtgaacttcatgacttgc
ttgagcatagaccgcttcttcgctgtggtgcaccctctgcgctacaacaagattaaaaga
atcgaatacgcaaagggtgtctgcctgtccgtctggattctggtctttgctcaaacactg
ccgctgctcctcacccctatgtctaaggaggagggagacaagaccacttgcatggagtat
ccaaactttgaagggacagcgtccctgccgtggattctgctcggagcctgtctgctgggc
tacgtgctgcctatcacagtcattctcctgtgttactctcagatctgctgcaaactcttc
aggactgccaagcagaacccactcaccgagaaatctggtgtgaacaaaaaggctctcaac
acaattatcctcatcattgtcgtgttcatcctgtgcttcacgccctaccacgtggccatc
attcagcacatgataaagatgctctgctcccctggagccctggagtgtggggcgagacat
tccttccagatctctctgcacttcacggtgtgcctgatgaacttcaactgctgcatggac
ccgttcatatacttctttgcatgcaaagggtataagagaaaggtcatgaagatgctcaaa
cgtcaagtgagtgtgtcgatctccagcgcagtgaggtcagcccctgaagagaattcgcgg
gaaatgacagagtctcagatgatgatccactccaaggcctccaatggaaggtaa

DBGET integrated database retrieval system