KEGG   Mus musculus (house mouse): 326618
Entry
326618            CDS       T01002                                 
Symbol
Tpm4, 2610528G24Rik, Tpm4.2, Tpm4.2cy
Name
(RefSeq) tropomyosin 4
  KO
K10375  tropomyosin 4
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04814  Motor proteins
mmu04820  Cytoskeleton in muscle cells
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04814 Motor proteins
    326618 (Tpm4)
   04820 Cytoskeleton in muscle cells
    326618 (Tpm4)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    326618 (Tpm4)
   04261 Adrenergic signaling in cardiomyocytes
    326618 (Tpm4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    326618 (Tpm4)
   05414 Dilated cardiomyopathy
    326618 (Tpm4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    326618 (Tpm4)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     326618 (Tpm4)
SSDB
Motif
Pfam: Tropomyosin Laminin_II CENP-F_leu_zip DUF3450 MscS_porin ATG16 CLZ GAS CCDC144C DUF724 DUF1664 EzrA CALCOCO1 Crescentin Fib_alpha Fez1 DUF745 FPP ISG65-75 CCDC93_CC TMF_DNA_bd XhlA Nuf2_DHR10-like Lebercilin DUF948
Other DBs
NCBI-GeneID: 326618
NCBI-ProteinID: NP_001001491
MGI: 2449202
Ensembl: ENSMUSG00000031799
UniProt: Q6IRU2
Position
8:72889132..72906986
AA seq 248 aa
MAGLNSLEAVKRKIQALQQQADDAEDRAQGLQRELDGERERREKAEGDAAALNRRIQLLE
EELDRAQEQLATALQNLEEAEKAADESERGMKVIENRAMKDEEKMEILEMQLKEAKHITD
EADRKYEEVARKLVILEGELKRAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSE
KEDKYEEEIKLLSDKLKEAETRAEFAERTVSKLEKTIDDLEEKLAQAKEENVGLHQTLDQ
TLNELNCI
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccggcctcaactcactggaggcagtgaagcgcaagatccaggccctgcagcagcag
gcagacgacgcagaggatcgcgcgcaaggcctgcagcgcgaactggatggcgagcgcgag
cggcgcgagaaagctgaaggagatgcagccgctctcaaccgccgcatccaactgctggag
gaggaactggaccgggctcaggagcagctggccacagccctgcagaatctggaagaggca
gagaaggctgctgatgagagtgagagaggcatgaaggtaatagagaaccgagccatgaaa
gatgaggaaaagatggagatcctggagatgcagctcaaagaagccaagcacatcactgac
gaagccgaccgcaagtatgaggaggttgctcgtaagttggtcatcctggagggtgagctg
aagagagcagaggagagggcggaggtatctgaactaaagtgtggtgacctggaagaagag
ctcaagaatgtaactaacaatctgaaatcactggaggctgcttctgaaaagtattctgaa
aaggaggataaatatgaagaagaaatcaagcttctgtctgacaagctgaaggaggctgag
acccgagctgagtttgcagaaaggacagtttctaaactggagaagacaatcgatgacctg
gaagaaaaacttgcccaggccaaagaagagaatgtgggcttacatcagacactggaccag
acactaaacgaacttaactgtatataa

DBGET integrated database retrieval system