KEGG   Mus musculus (mouse): 327747
Entry
327747            CDS       T01002                                 

Gene name
Mettl24, 9030224M15Rik
Definition
(RefSeq) methyltransferase like 24
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Methyltransf_22 Methyltransf_21
Other DBs
NCBI-GeneID: 327747
NCBI-ProteinID: NP_808461
MGI: 3045338
Ensembl: ENSMUSG00000045555
Vega: OTTMUSG00000027975
UniProt: Q8CCB5
Position
10; 10 B1
AA seq 363 aa
MATVKPPGRGCGALPRWLLGAALLLGLRLCMELRHAGSGPPGRGDSPGPPRTHLLSAPGS
PRGARRRQVTYVRSGRRVLPRGGGSTTSPEPSCCAQGGLLRRKGSRWHIELQPWAGPSRS
LDEEASRFLSYISTTQIACDHMGTDSLATDSSPAPKPWLVCLDDRFGLAHQIRSKRCRLY
SLGLGSDDTHFEVSMANGGCEVHRFDPSVKSAHVLERQGLWHHRLSIDWRDPHPAVAAQK
PHGNTRKLGSILNEFGHHKIDVLKADLESAEWKVLENLILEDVLEQIGQLVFEIHLHWPG
FEVSGSESGVVRFWYSLLKELERKHFRLFHTYKDLTKPQLFLKKDLFNASSCYTLSWVNT
KWR
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggccactgtcaagcctcccgggcgtggttgtggagccctgccccggtggctgctcggt
gccgcgctgcttctgggcctacggctttgcatggagttgcgccacgcgggctcgggaccc
ccgggccgcggcgattccccagggccaccccggacacacctactgtcggcgcccggctcc
ccacgcggagccagaaggaggcaggtgacctacgtgcgcagtgggcgccgagtgctgccc
cggggtggcgggagcacgacgtccccagagccgagctgctgtgcccagggcgggcttctc
cgcaggaagggttcccgatggcacatagagctccagccatgggcaggcccttctcggtcc
ctggatgaagaggcctcaaggttcctgagctacatcagtaccactcagattgcatgcgat
cacatgggtacagacagcttggctactgactccagccctgcaccgaagccctggctggtg
tgtcttgatgacaggtttggcttagctcatcaaatccgcagcaagcggtgccgcctctac
tctttagggctggggagtgatgacacacactttgaggtgagcatggccaacggtggatgt
gaagtgcatcgttttgatccgagtgtcaagtcagcccatgttctggagcggcagggcctc
tggcatcaccgcttgtccatcgattggcgggatccgcatccagccgtggctgctcagaag
ccgcacggcaacaccagaaaactgggaagcattctgaatgaatttgggcaccacaagatc
gacgttctcaaggcagatctggaaagtgcggagtggaaagttctggaaaaccttattctg
gaggatgttcttgagcagatcggccagctcgtcttcgagattcatcttcactggcccggt
tttgaggttagcggcagcgagagcggcgtggtgcgcttttggtacagcctcctgaaggag
ttggagcggaagcacttccgactttttcacacctataaagacttaacgaaacctcagctt
ttcctgaagaaggaccttttcaacgctagcagctgttataccttgagttgggtgaataca
aagtggaggtga

DBGET integrated database retrieval system