KEGG   Mus musculus (mouse): 327826Help
Entry
327826            CDS       T01002                                 

Gene name
Frs2, 4732458E18, C330018A15Rik, Frs2alpha, SNT1
Definition
(RefSeq) fibroblast growth factor receptor substrate 2
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    327826 (Frs2)
  09159 Environmental adaptation
   04714 Thermogenesis
    327826 (Frs2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    327826 (Frs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS
Motif
Other DBs
NCBI-GeneID: 327826
NCBI-ProteinID: NP_808466
MGI: 1100860
Ensembl: ENSMUSG00000020170
UniProt: Q8C180
Position
10; 10 D2
AA seq 508 aa AA seqDB search
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGVMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
SSHQTELEVPRTPRTPTTPGLGAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRASVHVPPEARVSNAESNTPKEEPSNPEDRDP
QVLLKPEGVRFVLGPTPVQKQLMEKEKLEQLGKDPVSGSGAGNTEWDTGYDSDERRDVPP
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRPALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIDYSKRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagataaagacactgtcccagataaccatcggaacaag
tttaaggtcattaatgtggatgatgatgggaatgagctaggctctggtgtgatggaactc
acagacacagagctgattctgtacacccggaaacgggactcggtaaaatggcactacctc
tgcctacgacgatacggctatgactcaaatctgttttcttttgaaagtggtcgaaggtgt
cagactggacaaggaatttttgcttttaagtgtgcccgtgcagaagaattatttaacatg
ttgcaagagattatgcaaaataatagtataaatgtggtggaagagccggttgtagaaagg
agtagtcatcagacagagctggaagtccctaggacacctcggacacctacaactccaggg
ctcggtgctcagaacttacctaatgggtatccccgctacccctcgtttggagacgcttca
tcccacccctcaagccggcatccttcggtgggaagtgctcgcttaccttcagtcggtgaa
gagtccacacaccctttgctcgtggctgaggaacaagtacatacttatgttaacactaca
ggtgtgcaagaggagcgaaaaaaccgtgcaagtgtgcatgttcccccagaggcaagggtt
tctaatgctgagagcaacacaccaaaagaagagccgagtaaccccgaggacagggacccg
caagtgcttcttaagcctgaaggagtcaggtttgtgctaggaccaacccctgtccagaag
cagttaatggaaaaggagaaactggagcaactgggaaaagacccagtcagtgggagtgga
gcgggcaacacggagtgggacaccggctatgacagtgacgagcgcagagatgtgccccct
gtcaacaaactggtgtatgaaaatataaacgggctatctattcccagtgcctcaggggtc
aggagaggtcgtctgacatctaccagcacctcagacacccagaatatcaacaactcagcg
cagagaagacctgcactattaaactatgaaaatttaccatctttgcctcctgtttgggaa
gcccgcaagctcagtagggatgaagatgacaatttaggaccaaagaccccatctctaaat
ggctaccataataatctagatccaatgcataactatgttaatacagagaatgtaacagtg
ccggcaagtgctcacaaaatagactattcgaagcgcagggattgtacaccgacagtcttt
aactttgatatcaggcgacccagtttagaacataggcaactcaattatatacaggtggat
ttggaagggggcagtgactctgacaaccctcagactccaaaaacgccgaccactcccctc
ccgcaaacccccacgcggcgcacagagctgtacgctgtgatagacattgagagaactgct
gctatgtccaacttgcagaaagcgctgcctcgagacgacggtacatctcggaagacgagg
cacaatagtactgacctgcccatgtga

DBGET integrated database retrieval system