KEGG   Mus musculus (mouse): 327942
Entry
327942            CDS       T01002                                 

Gene name
Pigl, Gm737
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis, class L
  KO
K03434  N-acetylglucosaminylphosphatidylinositol deacetylase [EC:3.5.1.89]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00065  GPI-anchor biosynthesis, core oligosaccharide
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    327942 (Pigl)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.89  N-acetylglucosaminylphosphatidylinositol deacetylase
     327942 (Pigl)
SSDB
Motif
Pfam: PIG-L Ifi-6-16
Other DBs
NCBI-GeneID: 327942
NCBI-ProteinID: NP_001034625
MGI: 2681271
Ensembl: ENSMUSG00000014245
Vega: OTTMUSG00000005858
UniProt: Q5SX19
Position
11; 11 B2
AA seq 252 aa
MELVGFLCVAVAVLTWGFLRVWNSAERMRSPEQAGLPGAGSRALVVIAHPDDEAMFFAPT
MLGLARLEQQVSLLCFSSGNYYNQGEIRKKELLQSCAVLGIPPSRVMIIDKRDFPDDPEV
QWDTELVASTLLQHIHANGTDLVVTFDAEGVSGHSNHIALYKAVRALHSGGKLPKGCSVL
TLQSVNALRKYAFLLDLPWTLLSPQDVLFVLTSKEVAQAKKAMSCHRSQLLWFRYLYVLF
SRYMRINSLRFL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggaattggtgggtttcttgtgtgtggccgtggctgtcctgacttggggcttcctccgg
gtttggaactcagcggaacgaatgaggtctccggagcaggcgggcctgccgggagccgga
agccgggcccttgtagtgatcgcgcacccggacgatgaagccatgttctttgctcccacc
atgctaggcttggcacgcctggagcagcaggtgtccctgctctgcttctcctcaggaaac
tactacaatcaaggtgagattcgaaagaaagagcttctgcaaagctgtgctgtgttgggg
attccaccttcccgtgtaatgattattgacaagagggactttccggatgatccagaagtg
cagtgggacacggagctcgtggccagcaccctccttcagcacatacatgccaatggcact
gacctggtggtgacttttgatgcagaaggagtcagtggtcacagcaaccatattgctttg
tacaaagctgtgagggccctgcactcaggagggaagctgcctaaagggtgctccgtgctc
acgctccagtctgtgaacgcgcttcggaagtacgccttcctcctggatctgccctggact
ctgctgtcaccccaggatgttctctttgtgctcaccagcaaagaagtggcacaggccaag
aaagccatgtcctgccaccgcagccagctcctctggttccgatacctctacgtcctcttc
tccagatacatgagaatcaactcactgcggttcctctga

DBGET integrated database retrieval system