KEGG   Mus musculus (mouse): 327956
Entry
327956            CDS       T01002                                 

Symbol
Vmo1, Gm741
Name
(RefSeq) vitelline membrane outer layer 1 homolog (chicken)
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: VOMI DUF3778
Other DBs
NCBI-GeneID: 327956
NCBI-ProteinID: NP_001013625
MGI: 2685587
Ensembl: ENSMUSG00000020830
Vega: OTTMUSG00000006061
UniProt: Q5SXG7
Position
11; 11 B3
AA seq 201 aa
MELQAGARLLLLLGVMCYGHAQIQVHVEPRYASIVDVTNGGTWGDWAWPEMCPDGYFASG
FSVKVEPPQGIPGDDTALNGIRLHCTRGNSQKNTHVVESQSGSWGSWSEPLWCPGTSFLV
AFCLRVEPFTFPGDNTGVNNVRFRCSDGVELEGPGLNWGDYGEWSNSCPKGVCGLQTKIQ
KPRGLRDDTALNDIRIFCCAS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggagttgcaggctggagccaggctgttactgctgctgggggtgatgtgctatggacat
gcacagattcaagttcacgtagaaccacgctatgcatcgatcgttgacgtgaccaacggt
ggtacctggggtgattgggcctggcctgagatgtgtcctgatggatactttgccagtggg
ttctctgtcaaggtggagccccctcaaggcattcctggagatgacacagctctgaatggg
atccggctacactgcactcgagggaactcacagaaaaacacccacgtcgtggagtcccag
tccggaagctggggttcatggagtgagcctctgtggtgtcctggcactagcttcttagtg
gctttctgcctccgggtggagccatttacattcccaggggacaacactggagtgaacaac
gtgcgcttccgttgctcagacggcgtggagctggaggggcctgggctgaactggggagac
tacggagagtggagcaactcatgtcccaaaggtgtctgtggcttgcagaccaaaatccag
aagccaagaggcctccgagatgacactgcacttaatgacatcagaatattctgctgtgcc
agctga

DBGET integrated database retrieval system