KEGG   Mus musculus (mouse): 328059
Entry
328059            CDS       T01002                                 

Symbol
Slc7a15, Arpat
Name
(RefSeq) solute carrier family 7 (cationic amino acid transporter, y+ system), member 15
  KO
K13868  solute carrier family 7 (L-type amino acid transporter), member 9/15
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    328059 (Slc7a15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    328059 (Slc7a15)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   328059 (Slc7a15)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 328059
NCBI-ProteinID: NP_001033749
MGI: 3045351
Ensembl: ENSMUSG00000020600
Vega: OTTMUSG00000027490
UniProt: Q50E62 Q8BZV2 Q9D8H4
Position
12:complement(8578481..8649066)
AA seq 488 aa
MERSEEKDGSNKPAGQEQGSGTAGLMLKREIGLWSAVSMTAGCMIGSGIFMSPQGVLVYI
GSPGASLIVWATCGLLAMLGALCYAELGSLVPESGGDYAYILRTFGSLPAFLVIYVYVLV
GRPAGITAVSLSFAEYVLAPFYPGCSSLPQVIVKIVASSCILLLLLINFWSSRMSTVLMN
VCTTAKVFSLLVIVVGGAVVLMQGHASTESLLFAFHNTTQQAGRIGMAFYQGLWSFDGWS
NINTVIEELKNPKQNLLWAVMTAVPLVTILYVLVNISYLLVMSPSEILSSDAIAVIWGDR
VLGSWAWLVPLAVALSTFGTVNGGFFSGSRVCYAAAREGHMPQLMSMIHVNRLTPAPAQI
FTTAVALLLVIPGNFSTFVNLLSFLSWLTYGTTFACLLYLRIKTKNLPHTYKVPTFIPAI
MLLVSLYLVLAPIIDHPQIEFLYIFLFVLSGFPVYFLLFHFQCQFKCIQTATMHLQLLLE
VAPTTKDH
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagcgaagtgaggagaaagatggcagcaacaagcccgcggggcaagagcagggcagt
gggacagcggggctgatgctgaagagggagattggtctgtggagtgcagtgtccatgacc
gctggctgtatgattggttctggcatcttcatgtcaccacaaggggtcttggtttacata
ggcagtcctggagccagtcttattgtctgggcaacctgtggactcctggccatgctgggt
gccctgtgctatgctgaactgggcagcctggttcctgagtctgggggagattatgcctac
attttgcgaacctttggctctctacctgccttcctggtcatctacgtatacgttctggta
ggcagaccagccggcatcactgcggtttcgctgagtttcgctgagtatgtactggctccc
ttttacccaggctgctcctcgctccctcaggtcatagtcaagattgtggcttcttcttgc
atcctgctgctgcttttgatcaatttctggagctcacggatgtccactgtgctgatgaac
gtgtgcacgactgccaaagtgttctcgctgctagtcattgtagtgggtggggctgtggtg
ctgatgcagggccatgcttccacagaatccctgctgtttgccttccacaacacaacacag
caggcagggcgcattggcatggctttctaccaggggctgtggtcctttgatggctggagt
aatatcaacacagtgatagaggagctcaagaatccaaagcagaacctgctgtgggcagtg
atgactgccgtccccctggtcaccatcctgtatgtcctggtcaatatcagttacctgctg
gttatgtcaccctcagagatcctctcctctgatgccatagctgtgatctggggggaccga
gttctggggtcctgggcctggctggtgcccttggctgttgctctttcaacatttggcact
gtcaatggggggttcttcagcggcagccgcgtgtgctatgcagctgcgagagaaggtcac
atgccgcagcttatgtccatgattcacgtgaatcgactgacaccagccccagcccagatc
ttcaccacggctgtggctttactgctggtcatcccgggaaacttcagcacctttgtgaac
ctcttaagcttcctgtcctggctcacctatggaactacctttgcctgtcttctgtatttg
cgaataaagacaaagaatctcccccacacttacaaggttcccaccttcatccctgccatc
atgctcctggtgtctctctacctggtgttggcacccatcattgaccacccgcagatagaa
ttcctatacatcttcctgttcgtgctcagtggcttcccggtgtacttcctgcttttccac
ttccagtgtcagttcaagtgtatacaaacggccactatgcatctccagctgctcctggaa
gttgctccaaccactaaagatcattga

DBGET integrated database retrieval system