KEGG   Mus musculus (house mouse): 328274
Entry
328274            CDS       T01002                                 
Symbol
Zfp459, 9930025G17Rik, Rslcan-14
Name
(RefSeq) zinc finger protein 459
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    328274 (Zfp459)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    328274 (Zfp459)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    328274 (Zfp459)
SSDB
Motif
Pfam: KRAB zf-C2H2 zf-H2C2_2 zf-C2H2_4 C1_4 zf-met zf-C2H2_11
Other DBs
NCBI-GeneID: 328274
NCBI-ProteinID: NP_808479
MGI: 3040701
Ensembl: ENSMUSG00000055560
UniProt: Q8BZ17
Position
13:complement(67546786..67591421)
AA seq 267 aa
MLSFRDVAVDFSAEEWECLEPAQWHLYRDVMLENYSHLVFLGLADSKPQLVTFLEQRQGS
TGEERQAVKAVFPGITPNDPNHYSKPTNCESLLLKRRRINTGEKPYKCEECGKALSSHKT
LSIHQRLHTGDKPYKCEVCHKAFCAPSSLFIHQKNHTDEKNFKCEDCGRTFYYLSMLKQH
QRIHSGEKCYKCKNCGYASYDPSFLEQHQKINCREKCYKCEDCHKAFHHQPLGYTREFIL
ERNLSNVKSVADVLGYLNPLSNIKKST
NT seq 804 nt   +upstreamnt  +downstreamnt
atgctgtcattcagggatgtggccgttgatttctctgcagaagagtgggaatgcctggag
cctgctcagtggcatctgtacagggatgtgatgctggagaattacagccaccttgtgttc
ctggggcttgctgactctaagccacagctggtgacatttctggagcaaagacaaggctct
actggtgaagagagacaagcagtaaaagcagtgttcccaggaataacacccaatgatcct
aaccattacagcaagcccactaattgtgaatcactccttcttaaacgaagaagaattaat
acaggggagaaaccctacaagtgtgaagaatgtggtaaggcccttagttctcataaaaca
ctttctatacaccagagacttcatactggagacaaaccctacaagtgtgaagtgtgtcat
aaggccttctgtgctccctcatcactttttatacaccagaaaaatcatactgatgaaaaa
aacttcaagtgtgaagactgtggcagaacattttactatctttcaatgctgaagcaacat
cagagaattcattctggggagaaatgttacaagtgcaaaaattgtggatacgcttcttat
gacccttcattccttgagcagcatcaaaaaattaattgtagggagaaatgctacaagtgt
gaagactgtcacaaagcctttcatcatcagcccttaggatacacaagagagttcatactg
gagagaaacctttcaaatgtgaaaagtgtggcagatgttttagggtatctaaatccctta
agcaacataaaaaaatccacttaa

DBGET integrated database retrieval system