KEGG   Mus musculus (house mouse): 328417
Entry
328417            CDS       T01002                                 
Symbol
Parp4, ARTD4, Adprtl1, C030027K23Rik, E230037B21Rik, Gm743, PARP-4, PARPL, PH5P, VAULT3, VPARP, p193
Name
(RefSeq) poly (ADP-ribose) polymerase family, member 4
  KO
K10798  poly [ADP-ribose] polymerase 2/3/4 [EC:2.4.2.30]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03410  Base excision repair
mmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    328417 (Parp4)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    328417 (Parp4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    328417 (Parp4)
   03036 Chromosome and associated proteins [BR:mmu03036]
    328417 (Parp4)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    328417 (Parp4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     328417 (Parp4)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    328417 (Parp4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    328417 (Parp4)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     328417 (Parp4)
SSDB
Motif
Pfam: VIT PARP Drf_FH1 VIT_2 VWA_3 BRCT_2 VWA BRCT VWA_2 PTCB-BRCT PARP_reg DUF6473
Other DBs
NCBI-GeneID: 328417
NCBI-ProteinID: NP_001139450
MGI: 2685589
Ensembl: ENSMUSG00000054509
UniProt: E9PYK3
Position
14:56812982..56897256
AA seq 1969 aa
MTLGIFANCIFCLKVKYLPRQQKKKLQTDIKENGGKFSFLLNPQCTHVIVDSADVLSRCH
LNSIQKNDVQIANPAFIQDSVRQRRLLDVRNYDPLSPAPAAPPAERSRSEVQSEYLPSDN
TPEKENTEVTEVSAENVEIPPFLQDFEVVKYNILEKVGGPETVVVELQSSQDPESCPFVI
TAHFLLADQKTRRESTGKQTSEGAIEYYESYVEDLKRQGFLLQEHFTAEATQLASEKLQA
LLLEEVISSGALSQEVSDLLEVIWTEALGHLENTLLKPVNSMSLNDVSKAEGILLLVKTA
LKNGDSPGQLQKTMAEFYRLLPHRHPASEEVNLRLLAQKEDLCQLVRDMVNVCETNLSKP
NPPSLAKYRALRCKIEHVDQNTEEFSRVRKEVLQNNRSEQPVDILQIFRVGRVNEATEFL
SKLGNVRLLFHGSPVRNILGILSRGLLLPKVAEDRGVQRTDVGNLGSGIYFSDSLSTSIK
YAHAGETDGSRLLVVCDVALGKCVNLFKKDFSLTEAPPGYDSVHGVSETTSVPTDFQDDE
FVVYKTNQVKMKYIVKFCTPGDQIKEFHPHENTEVEEQRAEPSSVPEAGDFQLPDIKPFT
NIKAGLQDASANPVPLDSVHIKGRVIDFVAQVIVFQTYTNQSHVPIEAKYIFPLDDKAAV
CGFEAFINGKHIVGEIKEKEEARQEYREAVSQGHGAYLMDQDTPDVFTVSVGNLPPRAKV
LIKITYITELSIQSPVAIFFIPGTVAPWQQDKALNENLQDTVETIRIKEIGAEQSFSLAM
SIEMPYMIEFISSDTHELRQKSTDCKAVVSTVEGSSLDSGGFSLHIGLRDAYLPRMWVEK
HPEKESEACMLVFQPELADVLPDLRGKNEVIICLDCSSSMEGVTFTQAKQVALYALSLLG
EEQKVNIMQFGTGYKELFSYPKCITDSKMATEFIMSAAPSMGNTDFWKVLRYLSLLYPSE
GFRNILLISDGHLQSESLTLQLVKRNIQHTRVFTCAVGSTANRHILRTLSQCGAGVFEYF
NSKSKHSWKKQIEAQMTRIRSPSCHSVSVKWQQLSRDAPEPLQAPAWVPSLFHNDRLLVY
GFIPHCTQATLQAFIQEKEFCTMVSTTELQKTTGTMIHKLAARALIRDYEDGILHDDETN
HEMKKNIMKSLIIELSKENSLITQFTSFVAVEKRDVNEIPFANVPNISELVAKEDVDFLP
YVSWQEKQPEASISQTEIDSSRLKHNKLSDGHGVLQPVSVSSEVNEKPSLLLAAKKRKIK
TIKKCSLDISEDFEDRTAVAQSPATAQSLNFHLPLSVRPQLKAVEQQLHGNRLEPKQRGG
FRKLLMAKKCRNVPDSLVSSAPAVTAEFSYLSACSSSSAFLSPLCDIPSSLPPHPLGGTH
PPPPLPLPDGTHLPSPLFGSTHPPPPLFGGTLIPPPSSLFGGTHLPPPPPLPGGTHIPPP
PPIPGGTLIPPSSSLFGGTHLPPPPLLSAGTHIPPPPLLSAGTHLPPPPLLPAGTHIPPP
PPITGSTHPPPPSSLFGGTHLPPPPPLPGGTHIPPPPPIPGGTLIPSPSSLFGGTHLPPP
PLLPAGTHIPPPPPITGSTHPPPPSSLFGGTHLPPPPPAGTQFSLSPIGFIPPKLGPPKL
SHSHKLVGDTNIHDSEPPLLGFKDLCSRDMGFSCGTAFSGSFASSKDFDPGKFSQGPNNI
SFSPKAPEMGVLHQSPFCSPPKPPSAPPLVTNVLCSEAPQSYFLNLQSAAVHQSPNNRVS
EIIMESVESSLPSDYSSRDASSYLALEGAEDSLLGGSSFETDTDEAAAFIANDLLTSIET
SSDEECAFCDEDQESPVPWASLFALQTENGFWKLTPELGLILNLNVNALLTSLEEKGIRS
LGTKGRERLLDLIATLLVLQFLYTKLEQEGMVAKSLIKMDDAFISRNIPWAFENIKKARE
WARKTEGQYPSICQRLELGKDWESATKQLLGIQPQANTSLHRILYYSQG
NT seq 5910 nt   +upstreamnt  +downstreamnt
atgactttaggaatctttgcaaattgtatattctgcttgaaggtcaagtacttacctcgt
cagcagaagaaaaagctgcaaactgatattaaggaaaatggcggaaagttttccttttta
ttaaaccctcagtgcacacatgtcatcgtagacagtgctgacgtcctgagtcggtgtcat
ctgaactccatccaaaagaacgatgtgcagattgccaacccagcattcatccaggactct
gtgagacagaggagactcctggatgtgaggaattatgatcctctgtcgccggctccagca
gcaccaccagctgaaaggagcaggtctgaagtgcaatcagaatatctgccttcagacaac
accccagagaaggaaaacaccgaagtcactgaggtttctgcagagaatgttgaaattccc
ccctttcttcaagactttgaagttgtgaaatataacatcttggaaaaggtaggaggcccc
gagactgtggtggtagagctgcagagctcccaggacccagagagctgcccctttgtgata
acagcacacttcctcctggctgatcaaaagaccaggagagagagcactggaaagcaaact
tctgaaggtgcaattgaatattatgaaagttatgtggaagacctgaagagacaaggattt
ctgctccaagaacactttacggccgaagcaacacagttagcgtctgagaaactgcaggcg
ttgcttttggaggaggtcattagttcaggcgccctgagccaggaggtgagcgatttgctg
gaggtgatctggacagaagctctgggccacctggagaacacgctcctcaagccagtgaac
agcatgagcctgaatgacgtgagtaaagcagagggaattctccttctggtgaagacagcc
ctgaagaatggagactcgcccggacaactgcagaagacaatggccgagttctaccgcttg
ctgcctcacaggcatccagcctcagaggaagttaacctgaggctgttggctcaaaaagag
gacctttgtcagctggtaagagacatggtgaatgtttgtgaaactaatttatccaaaccc
aacccaccatctcttgccaaataccgtgctttgcgatgcaaaatcgaacatgttgaccag
aacactgaagaattttccagggttagaaaagaagtgttgcagaataatcgaagtgaacaa
ccagtagatatcttgcagatatttagagttggcagagtgaatgaagctacggagttttta
agcaaactgggcaacgtgcgactcttatttcatggatctcctgtgcggaacattcttgga
atcttgtcccgagggctgctcttacctaaggtagctgaagaccgcggtgtacagagaaca
gatgttggaaatctcgggagcgggatctacttcagcgactcactcagtacaagcattaag
tatgcacacgcaggagagacagatgggtccagactcctggtcgtctgtgacgttgccctg
ggaaagtgtgtgaacttattcaagaaggacttttctttaactgaggcgccaccaggctat
gacagtgtgcatggagtttcggaaaccacctctgtccccacagactttcaggacgatgaa
tttgttgtatataaaaccaaccaagttaaaatgaaatacattgttaaattttgcactcct
ggagatcaaataaaggaattccatcctcatgaaaataccgaagtagaggagcaaagggct
gagccctccagtgttccagaggctggagatttccagttaccagacatcaagcccttcaca
aacatcaaagccggccttcaggatgcatctgcgaatcctgttcctcttgacagtgttcac
attaagggaagagtaatagacttcgtagcccaggtcattgtttttcagacatacacgaat
caaagccacgtgcctattgaggcaaaatatatcttcccattggatgacaaagcagctgtg
tgtggcttcgaggcattcatcaatgggaagcacattgtgggagagataaaggaaaaggaa
gaggcccggcaggagtaccgagaggctgtcagccaaggccatggtgcttacttgatggac
caggacactccggatgttttcactgtaagtgttggaaacttaccccctcgggctaaagtc
ctcatcaaaatcacctacatcacggaactcagcatccagagtcctgtggccatcttcttc
atccctggcactgtagcaccctggcaacaggacaaggcgttgaatgagaaccttcaggat
acagtggagacaattcgtataaaggaaattggagcagagcaaagcttctccctggctatg
tccattgagatgccctacatgattgaattcatttccagtgacacacatgaactgagacaa
aagagcacagactgtaaagctgtggttagcactgtggaaggcagctccttggacagcggt
ggattttctctccacattggtttgcgtgatgcatacctcccaagaatgtgggttgaaaaa
catccagaaaaagaaagcgaggcctgcatgcttgtctttcaaccggagcttgcggacgtc
ctccctgacctccgtggaaagaacgaagtgattatttgtcttgactgttccagttccatg
gagggtgtgacattcacacaagccaagcaggttgccctgtatgctctgtctttgctgggt
gaagagcagaaagtcaacattatgcaatttggcacaggttacaaggaactgttttcatat
cctaagtgcatcacggacagtaaaatggccacagagttcattatgtctgcagcaccttcc
atggggaacacagacttctggaaagttctccgctatttaagtctcctgtacccttcagaa
gggttccggaacattctcctcatatctgatgggcacctccagagtgagagtctgacactg
cagcttgtgaaaagaaatatccagcacaccagagtgttcacctgtgctgttggttccaca
gcaaatcgtcacatcttaaggaccttgtctcagtgtggcgctggagtatttgaatatttt
aactcaaaatctaagcacagttggaaaaaacagatagaagctcaaatgaccaggatacgt
tccccaagttgccactctgtctctgtcaaatggcagcagcttagcagagatgcccccgag
cctctgcaggccccggcatgggtgccctctttgttccacaatgatcgactcctggtctac
ggcttcattcctcattgtacacaagcaactctgcaagcattcatccaagagaaagaattt
tgcacaatggtgtcaactacagagcttcagaagacaactgggactatgattcacaagctg
gcagcccgggcactaatcagagattatgaagacggcattctccacgacgatgaaaccaac
cacgagatgaagaaaaacatcatgaaatctctgattatcgaactcagtaaagaaaattct
cttattacacaatttacaagctttgtggcagttgagaaaagggacgtaaatgagattcct
tttgctaatgtcccaaatatttcggaacttgttgccaaagaagatgttgactttctacca
tacgtgagttggcaggaaaagcaaccagaggcctccatatcacagacagagattgattct
tcgagactaaagcacaataaactctctgatggccatggagtgctacagcccgtttccgtc
tcctctgaagtgaatgagaaaccatcactgctactcgctgctaaaaaaaggaaaataaag
actataaagaagtgcagtctagacatttctgaagattttgaagacaggactgcagtagca
cagtcacctgcaacagcgcagtctcttaatttccacctgcctctcagtgtccgcccacaa
ctgaaagctgtggagcagcagctgcatgggaaccggctggagccaaagcaaaggggagga
tttcgaaaactgctcatggcaaagaagtgtcgaaatgtgcctgattccctggtttcctct
gctcctgcagtcacagctgagttttcttacctttctgcctgcagctctagttctgccttc
ctgtctcctctctgcgacatcccttcttctcttcctccccatccccttggtggtacccac
cctcctccccctcttcctctccctgatggcacccatcttccttcccctctctttggtagc
acccaccctcctccccctctctttggtggcacccttattcctcccccttcttctcttttt
ggtggcacccatcttcctccccctccccctctccctggtggcacccatattcctccccct
ccacctatccctggtggcacccttattcctccctcttcttctctctttggtggcacccat
cttcctccccctccccttctctctgctggcacccatattcctccccctccccttctctct
gctggcacccatcttcctccccctccccttctccctgctggcacccatattcctccccct
ccccctatcactggcagcacccaccctcctcccccttcctctctctttggtggcacccat
cttcctccccctccccctctccctggtggcacccatattcctccccctccacctatccct
ggtggcacccttattccttccccttcttctctctttggtggcacccatcttcctccccct
ccccttctccctgctggcacccatattcctccccctccccctattactggcagcacccac
cctcctcccccttcctctctctttggtggcacccatcttcctccccctccccctgctggc
acccaattttctctttctcctataggattcataccacctaagttgggtccacctaagctt
agccacagccataaacttgtcggagataccaacatccatgactcagagccacctctcctg
ggctttaaggatttgtgctctagagatatgggctttagttgtggtaccgctttctcaggt
agctttgctagttcaaaggattttgatccaggtaaattttcccaaggccccaacaacatc
agcttctctcccaaagcccctgagatgggcgttcttcaccagtcacctttttgcagtcct
cctaagccaccttctgcccctcctcttgtcaccaacgtactttgctctgaggctcctcag
agctattttcttaatttgcaaagtgccgcagtgcatcagagccctaataacagagtgtca
gagatcatcatggagtcagttgagtcatctctcccatcagattactcttccagagatgcg
tcatcatacttggctctagaaggggcagaagactccttgctgggtggaagttcttttgaa
accgatacagatgaagcagcagcatttatagccaatgatcttttaacaagtattgagact
tcctcagatgaggaatgtgccttctgtgatgaagaccaggagagtcctgtgccgtgggct
tcactctttgctctacagactgagaatggtttttggaagctgacaccagaactaggactt
atattaaaccttaatgtaaatgctctgctcacttctcttgaagaaaagggcattcgatct
ctaggtacaaaagggcgagagcgtctcctggatctgattgccactttgctcgtactgcag
tttctttataccaagttggaacaagaaggaatggttgccaagtctctgataaagatggat
gacgccttcatttctaggaatattccatgggcttttgagaacataaagaaagcaagagaa
tgggccagaaagacagaaggacagtatccatctatctgccaacggcttgagctgggtaaa
gactgggagtcagccacaaagcaactactgggaattcagccccaagccaacacttctctt
caccgaattctatactacagccaaggctga

DBGET integrated database retrieval system