KEGG   Mus musculus (house mouse): 328505
Entry
328505            CDS       T01002                                 
Symbol
Skint7, C130057D23Rik
Name
(RefSeq) selection and upkeep of intraepithelial T cells 7
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: C2-set_3 V-set Ig_3 I-set C2-set_2
Other DBs
NCBI-GeneID: 328505
NCBI-ProteinID: NP_001136247
MGI: 3041190
Ensembl: ENSMUSG00000049214
UniProt: A7XV04
Position
4:111830121..111845457
AA seq 395 aa
MMKPEFFCFSGFCVYFLFLQVVVSSEKLRVTTPTRHLLARVGGQAELSCQVIPPHSVMHM
EVRWFRSGHSQPVYLYRGGHKMSEEAAPEYANRTEFVKEAIGEGKVSLRIHNINILDDGP
YQCSFNGSGFIDAAIMNLNVTAVGLETEIHVQAPDADGVMVECNSGGWFPRPQMEWRDSK
GATLPHSLKSYSQDEARFFYMKMTLLLTNMSHGSIICCIFNPVTGEEKQTSIILANELFN
RDRIWMESLASIVWIMLSVYILYIICFYWRTGCASGCLSKCFCVVTSWPVQIVHLLFCTG
TFFAIYLPHRSRVSLSDPQFPLYNNWITELLFVILFLTICFALPIILLFIQFQFTSLTKW
EKNKDGIMDQPRLGKAHETSSLYRKKTGKSWEQEK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgatgaagcctgagttcttttgcttttctggattctgtgtgtactttctttttctgcaa
gtggtagtatcttcagagaaactgagggtaactactcccacaagacacctgttagctaga
gtaggaggccaggctgagctcagctgccaggtgatcccaccacacagtgtgatgcatatg
gaggtacgctggttcaggagtggccattcccaacctgtttacctatacagaggtggccat
aaaatgagtgaagaagctgctcctgaatatgcaaatcgtacagagtttgtgaaggaggcc
attggagaaggcaaagtgtccctccgaattcataatataaacattttggatgatggacct
taccaatgttcatttaatggtagtggcttcattgatgcggctatcatgaacctcaatgtg
acagcagttggattggagacagagatacatgttcaggctcctgatgctgatggagtcatg
gtggagtgtaattcaggagggtggttcccaaggccccaaatggagtggagagatagtaag
ggggcaacacttccgcactcattaaaatcatattcacaggatgaagccagatttttctat
atgaagatgactcttctcctcacaaacatgtcacatggcagcatcatttgctgtattttc
aaccctgtaacaggtgaagagaagcaaacaagtatcattctagcaaatgaactctttaat
cgggaccgtatttggatggaaagtttagcttccattgtatggataatgctctctgtatat
attctatatataatctgcttttactggagaacagggtgtgcatctggatgcctgtctaaa
tgtttttgtgtggtgacctcctggcctgttcaaatagtgcatttattattctgtactgga
acattctttgcaatatatttacctcaccgcagcagagtctctctttcagatcctcagttt
cccttatacaacaactggataactgaattgctgtttgtgatactttttctgacaatatgt
tttgccttgccaatcattctcttattcatacaatttcaattcacaagtctgactaaatgg
gagaagaacaaggatggcatcatggaccaaccaagactgggaaaagcccatgaaacctca
agcctatatagaaaaaaaacaggaaaaagctgggagcaggagaagtga

DBGET integrated database retrieval system