KEGG   Mus musculus (mouse): 328572Help
Entry
328572            CDS       T01002                                 

Gene name
Ep300, A430090G16, A730011L11, KAT3B, p300, p300_HAT
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04520  Adherens junction
mmu04630  Jak-STAT signaling pathway
mmu04720  Long-term potentiation
mmu04916  Melanogenesis
mmu04919  Thyroid hormone signaling pathway
mmu04922  Glucagon signaling pathway
mmu05016  Huntington's disease
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    328572 (Ep300)
   04330 Notch signaling pathway
    328572 (Ep300)
   04350 TGF-beta signaling pathway
    328572 (Ep300)
   04630 Jak-STAT signaling pathway
    328572 (Ep300)
   04066 HIF-1 signaling pathway
    328572 (Ep300)
   04068 FoxO signaling pathway
    328572 (Ep300)
   04024 cAMP signaling pathway
    328572 (Ep300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    328572 (Ep300)
  Cellular community - eukaryotes
   04520 Adherens junction
    328572 (Ep300)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    328572 (Ep300)
   04919 Thyroid hormone signaling pathway
    328572 (Ep300)
   04916 Melanogenesis
    328572 (Ep300)
  Nervous system
   04720 Long-term potentiation
    328572 (Ep300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    328572 (Ep300)
   05206 MicroRNAs in cancer
    328572 (Ep300)
   05203 Viral carcinogenesis
    328572 (Ep300)
   05211 Renal cell carcinoma
    328572 (Ep300)
   05215 Prostate cancer
    328572 (Ep300)
  Neurodegenerative diseases
   05016 Huntington's disease
    328572 (Ep300)
  Infectious diseases
   05152 Tuberculosis
    328572 (Ep300)
   05166 HTLV-I infection
    328572 (Ep300)
   05164 Influenza A
    328572 (Ep300)
   05161 Hepatitis B
    328572 (Ep300)
   05168 Herpes simplex infection
    328572 (Ep300)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    328572 (Ep300)
   05169 Epstein-Barr virus infection
    328572 (Ep300)
   05165 Human papillomavirus infection
    328572 (Ep300)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     328572 (Ep300)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    328572 (Ep300)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    328572 (Ep300)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    328572 (Ep300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1 RNase_H2-Ydr279
Motif
Other DBs
NCBI-GeneID: 328572
NCBI-ProteinID: NP_808489
MGI: 1276116
Ensembl: ENSMUSG00000055024
Vega: OTTMUSG00000048223
UniProt: B2RWS6 Q8BJ14
Position
15; 15 E1
AA seq 2412 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAMASQAQQNSPGLSLINS
MVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLA
AGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGP
QPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGM
PSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
IPPQPQVQAKNQQSQPSGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINS
QNPMMSENAGVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
NAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMN
MPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTN
MPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTP
TPHHTPPSIGNQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSL
PAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTE
VNSQTIPEKQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKT
DGKEEEEQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDP
QLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKY
CSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFC
EKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLH
HEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEV
TVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEY
GSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPS
EGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKEL
PYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKS
SLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDPLIPC
DLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRW
HCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQS
LVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKC
PVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATPTTPTGQ
QPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAPGQVTPPTPPQTAQAPLP
GPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMSPMAPMGMNPPPMARGPGGH
LDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVS
PLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANPNPQP
LPGQPGMTQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMG
AMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQ
QQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQH
MLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADL
NSNLSQSTLDIH
NT seq 7239 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaacccgggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggttcactgtttgacctggaa
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggcgat
atcagtcagcttcagacaagtcttggcatagtacaagatgcagcctcgaaacataaacag
ctgtcagaactgctgaggtctggtagctccccaaacctcaacatgggagtcggtggccca
ggccaagcgatggccagccaggcccaacagaacagccctggattaagtttgataaatagc
atggtcaaaagcccaatggcacagacaggcttgacttctccaaacatggggattggcagt
agtggaccaaatcagggtcctactcagtccccagcaggtatgatgaacagtccagtgaac
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggct
gcaggcaatggacaagggataatgcccaatcaagtcatgaacggttccattggagcaggc
cggggacggccaaacatgcagtacccaaatgcaggcatgggcaatgctggcagtttattg
actgagccactacagcagggctctcctcagatgggaggacagccaggattgagaggcccc
caaccacttaagatgggaatgatgaacaatcccagtccttatggttcaccatacactcag
aattctggacagcagattggagcaagtggccttggtctccaaattcagacaaagactgtt
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtgggggaatg
cccagtatgggccagcagcctaccccatcggtccagcagccaggcctggtgactccagtt
gccgcaggaatgggttctggagcacacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctccttttacatgctcacaagtgccagcgccgggagcaagctaatggg
gaagtgaggcagtgcaaccttcctcactgtcgtaccatgaaaaatgtcctaaaccatatg
acacattgccagtcaggcaaatcctgccaagtggcacattgtgcatcttctcgacaaatc
atttcacactggaaaaattgcacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagcgaaatcaacagtcaattttgactggagcaccagttgggcttggaaac
cctagctctctaggagtggggcagcagtccactcctagcctaagcactgttagtcagatt
gaccccagctctatagagcgagcttacgctgctcttggactaccctatcaagtaaaccag
attccaccacaaccccaggtacaagcaaagaatcaacaaagccagccatctggacagtct
ccccagggcatgcggtctgtgaacaacatgagtgctagtcctatgggtgtaaatggaggt
gttggggttcagacgccaaatcttctttctgactccatgttgcattcaactataaattct
caaaacccaatgatgagtgaaaatgctggtgtggcctccctgggtcctttgccaacagca
gctcagccatctagtactggaattcgaaaacagtggcatgaagatattactcaggatctt
cgaaaccaccttgttcataaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagaccgacggatggaaaatcttgttgcatatgctcgtaaagtggaaggggacatg
tatgaatctgcaaacaatagagcggaatactatcacctcctagccgagaagatctataag
atccagaaggaactagaagagaaacgaaggactagactacagaaacagaacatgctaccg
aatgctcctggcatgggtccagttcctatgaatactgggtcgaacatggggcagcaacca
acaggaatgactaccaatggtcctgtacctgacccgtctatgatccgtggcagtgtgccg
aaccacatgatgcctcggatgactccacagcctggtttgaatcaatttgggcagatgaat
atgccacagccccctattggaccccggcaaccctctcctcttcagcaccatggacaattg
gctcagtctgggtcactcaatccgcctatgggctatggacctcgcatgcagcaggcttcc
ggccagaaccagttcctctcccagactcagttcacatcccaaggaatgaatgtaacaaac
atgcctttggctccatccagcggtcaagcaccagtgtctcaagcacaaatgtccagttct
tcttgcccagtgaactctcctataatgcctccagggtctcaagggagccacattcactgt
cctactctgcctcaacaagctcatcagaattcaccttctcctgttcctagccgcacccct
actcctcatcatacccccccaagcatagggaatcaaccaccaccagcaacagcaattcca
acacctgttcctacacctcctgccataccacctggaccacagcccccatctctgcatccc
tcatctagacaaacacctacaccaccaacacatctgcctccccaagtgcagccttcactt
cctgctgctccttctgctgaccagtcccagcaacagcctcggtcacagcagagcacagca
gtttctgttcctaccccaacagcaccattgctgcctcctcagccttccactccgctttct
cagccagctgtgagcattgaaggccaggtctcaaaccctccatctactagtagcaccgaa
gtgaattctcagaccattcctgagaagcagccttcacaggaagtgaaaatggagtctaaa
atggaggtggataagccagaaccagcagatgctcaacctgaggatacaaaggaggctaaa
ggtgaggatgttaaagtagaacctacagaaatggaggagagaggccctgagttaaaaact
gatgggaaagaggaggaagaacagccaagcacctctgctacccagtcctccccagctcct
ggacagtcaaagaagaagattttcaaaccagaggaattacgacaggctctgatgccaaca
ttggaggcactttaccggcaggacccagaatctcttccctttcgtcagcctgtggacccg
cagcttctaggaatccctgattactttgatattgtgaagagccccatggatctttctaca
atcaagaggaagttagatactggacaataccaagagccctggcaatatatagatgatatt
tggcttatgttcaacaatgcctggttatataaccgtaaaacttcaagggtatacaaatat
tgctctaaactttctgaagtatttgaacaagaaattgaccctgtcatgcaaagccttgga
tactgttgtggcagaaagttggagttttctccacagactctttgttgctatgggaaacag
ttatgcacaatcccccgtgatgctacttactacagttaccagaacaggtatcatttctgt
gagaagtgtttcaatgaaatccaaggggagagcgtttctttgggtgatgacccttcccaa
cctcaaactacaataaataaagaacagttttccaagagaaaaaatgacacgttggatcct
gaactgtttgttgagtgcacagagtgtggaagaaagatgcaccagatctgtgtccttcac
cacgagatcatctggccatctgggtttgtctgtgatggctgtttaaagaaaactgcacga
actaggaaagaaaataagctttctgctaaaagattgccatctaccagacttgggaccttt
ctggagaatcgagtgaatgactttctgaggcgacaaaatcaccctgaatcaggagaggtc
actgttcgggttgttcatgcttctgacaaaactgtggaagtgaaaccaggcatgaaagca
aggtttgtagatagtggagagatggcagaatcttttccataccgaacaaaggccctgttt
gcctttgaagaaattgatggtgttgacttgtgtttcttcggcatgcatgttcaagaatat
ggctctgactgcccccctcccaaccagaggagggtatacatatcttacctcgatagtgtt
catttcttccgtcctaaatgcttgcggactgcagtctatcatgaaattctaattggatat
ttggaatatgtcaagaaattaggatacacaacagggcacatctgggcctgtccacccagt
gaaggggatgactatatcttccattgccatccacctgatcagaagataccaaagcccaag
cgcctgcaagaatggtacaaaaagatgcttgacaaggctgtatcagaacgtattgtccat
gactacaaggatattttaaaacaagctactgaagatcgattaacaagtgcaaaggaacta
ccctactttgaaggtgatttctggcccaatgttctagaagaaagcatcaaggagcttgaa
caggaagaggaagagaggaaacgggaagagaacaccagcaacgagagtactgatgtaaca
aaaggagacagcaaaaatgctaagaagaagaataacaagaaaaccagcaaaaacaagagc
agcctgagtaggggcaataagaagaagcctggtatgcccaatgtgtctaatgacctttct
cagaaactgtatgccaccatggaaaagcataaagaggttttctttgtgatccgcctcatc
gcttgtcctgctcccaattccctgcctcccattgttgatcctgaccctctcatcccctgt
gacctgatggacggtagagatgcatttctcacccttgcaagggacaagcacctggagttc
tcttcacttcgaagagcccagtggtctaccatgtgcatgctggtggagctccatacacag
agtcaggatcgctttgtctacacctgcaacgagtgcaagcaccacgtggagacacgctgg
cattgcactgtgtgtgaggattatgacctgtgcatcacttgttataacactaaaaatcat
gaccacaaaatggagaaactaggccttggcttagatgatgagagcaataaccagcaagct
gcagctacacagagcccaggagactcccgccgcctgagcatccaacgctgcatccagtct
ctggtgcatgcctgtcagtgccgcaacgccaactgctccctgccttcctgccagaagatg
aagagggttgtgcagcacaccaaaggctgcaaacggaaaaccaatggtgggtgccccatt
tgcaaacagcttattgccctctgctgctatcatgccaagcactgccaggagaacaagtgc
ccggtgccattttgcctcaacatcaagcaaaagctccggcagcaacagctgcagcaccgg
ctccaacaggctcagatgctccgtaggaggatggccagcatgcaacgaactggtgtggcg
gggcagcagcagggcctgccgtccccaactcctgctacaccaactacccctactggccaa
cagccagccaccccacagacaccccagccccaacccacctctcaaccacagcccactcct
cccaacaacatgacaccctacttacccaggactcagactactggccctgtgtcccagggt
aaggcaccaggccaggtgaccccacctaccccacctcagactgctcaggccccccttcca
gggcctccacctgcagcagtagaaatggcaatgcaaattcagagggcagcagagacacag
cgccagatggcccatgtacagattttccaaaggccaatccagcaccagatgccccagatg
tcacccatggcccctatgggcatgaacccacctcctatggccagaggtcctggtgggcat
ttggatccaggaataggtccagcaggaatgcagcaacagccaccttgggcccaaggagga
atgcctcagccccagcagatgcagtcagggatgccaaggccagccatgatgtcagtggcc
cagcatggtcagcctttaaacatggctccacaaccaggattgggccaagtgggtgtgagc
cctctcaagccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcagg
tctcccagttctcccttacagcagcaacaggtgcttagtatccttcatgccaacccccaa
ctgttggctgcattcatcaagcagcgggctgccaagtatgccaaccctaatccacagcct
ctccctggacagcctggcatgacccagggacagccagggctgcagccacctaccatgcct
ggccagcaaggtgtccactccaacccagccttgcagaacatgaatcctctgcaggcaggt
gtccagagagctggcctgccccagcagcagccgcagcagcagctccagccacccatggga
gcaatgagtccccaagctcagcaaatgaacatgaatcacaataccatgccttcacagttc
agagacatcttaagacggcagatgatgcaacagcagggagcagggccaggaatcggccct
ggaatggccaaccagttccagcagccccaaggaattggctatccaccgcagcagcagcag
cagcagcgaatgcagcatcacatgcagcaaatgcagcaaggaaatatgggacaaatgggt
cagcttccccaggctctgggggctgaggcaggagccagtctacaggcctatcagcagcga
cttcttcaacaacagatggggtctcctgctcagcccaaccctatgagcccacagcagcac
atgctcccaaatcaggcacagtccccacacctacaaggtcaacaaatccctaattctctc
tccaatcaagtgcgctctccccagcctgtcccttctcctcgaccacagtctcagcccccc
cattccagcccatctccgaggatgcagcctcagccttctccacaccatgtttctccacag
accagttccccacatcctggactggtagctgcccaggctgccaaccctatggaacaaggg
cattttgccagcccagaccagaattcaatgctttcacagctcgctagcaatcctggcatg
gcaaacctccacggggcaagtgccacggacctgggactgagcagcgataatgcagacttg
aattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system