KEGG   Mus musculus (mouse): 328643
Entry
328643            CDS       T01002                                 

Symbol
Vwa5b2, BB182430, EG328644, Gm1738, Gm931
Name
(RefSeq) von Willebrand factor A domain containing 5B2
  KO
K24510  von Willebrand factor A domain-containing protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    328643 (Vwa5b2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Von Willebrand domain-containing proteins
  VWA domain-containing proteins
   328643 (Vwa5b2)
SSDB
Motif
Pfam: VIT_2 VWA_3 VIT
Other DBs
NCBI-GeneID: 328643
NCBI-ProteinID: NP_001138425
MGI: 2681859
Ensembl: ENSMUSG00000046613
Vega: OTTMUSG00000026177
UniProt: Q3UR50
Position
16; 16 A3
AA seq 1248 aa
MPGLYCPTSWTPLPLTDSCVRAYAKGPCLSLRARLTYHNPQPQPVEGVFVYPLAEAEVVS
GFEAEAAGRRVSFQLHSRRRSQAACCRALGPGLGTSTPRRCAQGHLVLNLAQARSTLVLP
TGLVAAAGTMTVTLCSSRELPSRPDGVMHVALPTVFTPLAQPNLPGSPRSPGLCDDSPTS
CFGVGSPEEERPTWEQPTATPDVFSGPARCPAPYTFSFEMLVTGPCLLAGLESPSHALRA
DALPHASSAATIRVTLAEGHQCDRALEILLHPSEPHQPHLMLETGSLSSAEYEAQVRARH
DFQRLQQRDSGGERQVWFLQRRFHKDILLNPVLVLNFCPDLSSKPGHLNAATRELLFLLD
GSGAGHKDAIVLAVKSLPAQTLVNLAIFGTLVQPLFPESRPCSDDTVQLICESIETLQTV
NGPPDMLAVLDWALGQPQHRAYPRQMFLITAASPTAATTHQALEFMRWHRGAARCFSFAL
APACRQLLHDLSVLSRGQAYFLRPGERLQPKLVQALRKALEPALSDISVDWFVPDAVEAL
LTPREIPALYPGDQLLGYCSLFRVDGFRSHALGGQEPGWQSLAGSVFPSPEEVLSATSPG
TEPTHTTEPLGTGTVSAELSSPWAVGDSEQSMEALTDPVMDPGPNPSSDTAIWRRIFQSS
YIREQYVLTHCSASPEPGPGSTCSSESPGSQGPGSPSGSRPLDPPSQQGCRSLAWVEPAG
SRSCPLPVPPPSPFKVGAMSAEVLGRRQRAALAGRSLSSPSGRANPVPGRARHPSLDAIP
DGLGPEPGQQLGQGLDDSGNLLSPAPLDWDMLMEPSFLFKPVPSSAESAPPAECLPPQAP
RCHVVIRALCGEQPMCWEVGVGLEELWGPGDGSQPESLPMREAAWDQALHRLTAASVVQD
NEQLALRGRAETRAEQGRVRRSWLRAIQTSKVSSAPSCFTCPVAVDATTREVLPGALQVW
SSDPAELSGMSASQDQLAAAPLSTAVHSKGHQGGCSAGAWDLDLNDNSKSALGEPISPTG
DHHGLPHQPPASSRLSLGRHRRLCSSNKGQTHENSNDGSNHDYLPLVRLQEAPGSFRLDE
PFCAAVCIPQERLCRASPFAAHRASLSPTSASSPWAFLSPGIGQGDSATASCSQSPSSGS
EGPGQVDSGRGSDTEASEGMERQDSSDLRGRTWATAVALAWLEHRCAAAFGEWELTASKA
DCWLRAQHLPDGLDLTALKAAARGLFLLLRHWDQNLQLHLLCYSPSNV
NT seq 3747 nt   +upstreamnt  +downstreamnt
atgcctggcctgtactgccccaccagctggacgccgctgccgctcaccgactcctgcgtc
cgggcctatgccaagggaccctgcctcagcctgcgtgcccggcttacctaccacaaccca
cagccccagccggtggaaggcgtgttcgtgtaccctctggctgaggcggaggtggtatct
ggcttcgaggccgaggcggccggacggcgcgtctccttccagttgcatagccggcgccga
tcacaggccgcctgctgtcgcgctctgggcccgggactagggacctctacaccccgccgc
tgcgcacagggtcatcttgtcttgaatctggcccaagcccggtccacactggtgttgccc
actggccttgtggctgcagctggtaccatgacagtgaccctgtgcagcagccgggagttg
ccctccaggcctgatggggtgatgcatgtggccctgcccactgtgttcaccccactggcc
cagccaaacctgccagggtcccccaggtctccggggctctgtgacgacagccccaccagc
tgcttcggggtaggcagccctgaggaggaaaggccgacctgggagcaaccaactgccact
ccggacgtgttctcaggccctgcccgctgtcctgctccgtataccttctctttcgagatg
ctagtgaccggaccatgtctgttggcaggcctggagagcccctctcatgctctgcgtgca
gatgccctccctcatgccagctctgcagcaactatccgtgtcaccctggcagagggccac
cagtgtgatcgggccttggagatcctcttgcaccccagtgagccccatcagccacacttg
atgctggagactggcagcttgagttcagcagaatatgaggcccaagtgagggcccgccat
gacttccagaggttgcagcaaagagacagtggtggggaacggcaggtctggttcctgcag
cgacggttccataaggacatcttgctgaaccctgtgctggtgctgaacttctgcccagac
ctgagctccaagcctggacacctgaatgcagctacccgggagctcctcttcctgttagat
ggcagtggtgcaggacacaaggatgccattgttttggctgtaaaatccctcccagctcag
actctagtcaacctagccatatttgggacattggtacagccactcttcccagagagccgg
ccttgcagtgatgacactgtgcagctgatctgcgagagcatcgagactctccagactgtg
aatggtccccctgatatgctggctgtattggattgggccttagggcagccccagcacagg
gcctaccctcgacagatgttcctgatcactgctgcctcgccaacggctgccaccactcac
caagccctggagtttatgaggtggcacagaggggcagccaggtgcttctcctttgcattg
gcacctgcctgccgccagctgctccatgacttgtctgtcctcagcagaggacaggcttac
ttcctgaggcccggggagagacttcagcccaagctggtacaggctctgcggaaggcactg
gaacctgctttgagtgacatctctgtggactggtttgtgcctgatgctgtggaggcactg
ctgacaccccgggagatcccagctctctaccctggggaccagctgcttggctactgctcg
cttttcagggtggatggcttccggtcccatgctctagggggacaagagcctggttggcag
agcttggccggttcagtcttcccatctccagaggaggtgttatccgccaccagccctggc
actgagcctacgcacaccacagagcccctgggaacaggcactgtgtcagcagagctgtcg
agcccatgggctgtaggcgactcagagcagagtatggaagctctgacagacccagtcatg
gatcctggacctaatccctcatctgacacagctatatggcggcgcatcttccagtcctca
tacatccgggagcagtatgtgcttacccactgctctgccagccctgagccaggcccaggc
tccacctgcagtagcgagtccccaggttcccaaggccctggctcccccagtggtagccgt
cccctggatcccccttctcagcagggctgccgaagcctggcctgggtagaacctgcaggc
tcccgctcctgccccctgcctgtacccccaccatctccattcaaggtgggagccatgagc
gctgaggtgctgggccgtcggcaaagagcagctctggctggtcgaagtctctcatctccc
tcaggccgggcaaacccagtccccggaagagcccggcacccctctctagatgcaatacca
gatggattaggccctgagccaggacaacagctgggtcagggcctcgatgattcaggaaac
ctgctctccccagcccccttggactgggatatgttgatggaaccatctttcttattcaag
cctgtgccgtccagtgcggaatcagctcctccagcagaatgtctgcctcctcaggctcca
cgttgccacgtggtgatccgggccctgtgtggggaacagccaatgtgctgggaggtgggt
gttgggctggaagaactctggggtcctggggatggctcccagcctgaatcacttccgatg
agagaagctgcgtgggatcaggcactccaccggctgacagcagcctctgtggtccaggac
aatgaacagctggctctccgtggaagagctgaaaccagggctgagcagggcagagtcaga
aggtcctggctcagagccattcagacaagcaaggtcagctctgccccatcctgttttacc
tgccctgttgctgtagatgctaccactagggaggtattgcctggagccctgcaggtgtgg
agttcagatccagctgagctctcaggcatgtctgcctctcaagaccagctagctgccgct
cctctgtccacagcagtccactctaaaggacatcagggaggctgttctgcaggtgcctgg
gacctggacctaaatgacaactccaagtcagcattgggggagcccatatctcctactgga
gatcatcatggcttgccccaccagcctccagcctcttccaggctcagcctgggtcgtcat
cgaagactctgcagctccaataagggccagactcatgagaacagcaatgacggcagcaac
catgactacctgcctctggtacgactgcaagaggcaccaggctccttccgcctggatgaa
cccttctgtgctgctgtgtgcattcctcaagaacgcctgtgtcgagcctcgccctttgcc
gcacaccgtgccagcctcagccccacctcagcatcatctccttgggcatttctgagccct
ggtattggccaaggtgacagtgccacagcctcctgcagccagtcccccagctcaggttct
gagggtccaggccaggtagacagtgggaggggctcagatactgaggcctcagaaggaatg
gaaaggcaggacagctctgatcttcgtgggcgcacttgggccacagctgtggccctggcg
tggctggaacaccgctgtgcagctgcctttggcgagtgggaactgacagcttccaaagct
gattgctggctgagagcccaacacctgccagacggacttgatctgactgctcttaaagct
gctgcccgggggctctttctgttactgcgacactgggaccagaatctgcagctacacttg
ctgtgttacagcccttcgaatgtgtaa

DBGET integrated database retrieval system