KEGG   Mus musculus (mouse): 328801
Entry
328801            CDS       T01002                                 

Gene name
Zfp414, 0610030H11Rik, Znf414
Definition
(RefSeq) zinc finger protein 414
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-C2H2_8 zf-C2H2 zf-C2H2_4 zf-C2H2_6
Other DBs
NCBI-GeneID: 328801
NCBI-ProteinID: NP_080988
MGI: 1915641
Ensembl: ENSMUSG00000073423
Vega: OTTMUSG00000036514
UniProt: Q9DCK4 Q14A93
Position
17; 17 B1
AA seq 299 aa
MEEPSRPSSDTLTTVESSSGEPDKEVASPDGAAPATFSSVEEPSPNPTAMPPVWDHGGPL
QQVAYPASDSCQTGSTNTGVGTNEDLRLPRRRPPPGKQIPCSSPGCCLSFPSVRDLAQHL
RTHCPPTQSLEGKLFRCSALSCTESFPSMQELVAHGKLHYKPNRYFKCENCLLRFRTHRS
LFKHLHVCIDHGQNPAPPPPPALDKEPPVPERPPESDPSSSLGLPFPLLEPFTSAPTGPF
LPYLNPAPFGLSPPRLRPFLAATPGPPASSTAIWKKSQGATSSPRRPQGGSDAPSGACR
NT seq 900 nt   +upstreamnt  +downstreamnt
atggaggaaccatccaggcccagctcggacacgctgaccactgtagaatccagctccggt
gagccagacaaggaggtggcatctccagatggggcagctccagccactttttcctccgtg
gaggagcccagccctaacccaacagccatgccaccagtgtgggaccatggaggacctctg
cagcaagttgcctatccagcctcagacagttgccagactggctcaaccaacacaggcgtg
gggaccaatgaggaccttcggttgcccagacgccgtccaccgccagggaaacaaataccc
tgctctagccccggctgctgcctcagtttccccagtgttcgtgatctagcacagcatctc
cgtacccactgcccacccacacagtcactggaaggcaaactcttccgatgctccgcgctg
agctgcactgagagtttccccagcatgcaggagctggtagcccacggcaagctgcattac
aagcccaaccgctacttcaagtgtgagaattgcctcctgcgcttccgcactcaccgttca
ctcttcaagcatctgcatgtttgtatagaccatggtcagaacccagccccgccaccaccc
cctgccctggacaaagagccacctgtacccgagcgtcccccagagtccgacccttcgtct
tccctgggcctgccattcccactacttgagccttttacctctgcccccactgggcccttc
cttccatacttgaaccctgcaccctttggcctgagtccccctcgactgcgcccattcctg
gctgccactccagggccaccagcatccagcactgccatctggaagaagagtcaaggcgct
accagtagtcccagaagacctcagggtggctctgatgcgccctcaggtgcgtgcaggtga

DBGET integrated database retrieval system