KEGG   Mus musculus (mouse): 328830
Entry
328830            CDS       T01002                                 

Gene name
A530064D06Rik, Trem4, pdctrem
Definition
(RefSeq) RIKEN cDNA A530064D06 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 328830
NCBI-ProteinID: NP_001107028
MGI: 2443476
Ensembl: ENSMUSG00000043939
UniProt: Q8C239 Q8BNV8
Position
17; 17 C
AA seq 160 aa
MAWEPTYLLSPVLLLLLASGSWTQNPELLRTQEGETVSVTCWYDSLYHSSEKIWCKQIDN
LCYPFVSKSAEKPRFLIQQSSRFNFFTVTMTKLKMSDSGIYHCGIVANNTSVYLRNIHLV
VSKGALYPVLLFPWSVDSSARHWYSRSYSLSHRSHLDDRP
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcctgggagcccacatacctgctctccccagtgctgctgctgctcctggcctcaggc
tcctggacacagaacccggagttacttcgaacacaggagggtgagactgtttctgtgaca
tgctggtatgattcgctctaccactccagcgagaagatctggtgtaagcaaatagacaac
ttgtgttaccccttcgtcagcaaaagtgccgagaagccaagattcctcatccagcagtct
tctcgcttcaacttcttcactgtcaccatgactaagctcaagatgagtgactcgggcatc
tatcactgtgggattgttgcaaataacacgtcagtttatctcagaaatatccacctggtg
gtgtcaaaaggggctttgtatccagtgttactattcccgtggtctgtggactcctcagca
agacactggtattcacggtcttattcattgtcacacagaagtcatttggacgacaggcca
tga

DBGET integrated database retrieval system