KEGG   Mus musculus (mouse): 328949Help
Entry
328949            CDS       T01002                                 

Gene name
Mcc, D18Ertd451e, E330037C19
Definition
(RefSeq) mutated in colorectal cancers
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MCC-bdg_PDZ EF-hand_7 EF-hand_1 EF-hand_6 Mod_r FAM76 EF-hand_5 MAD Spc7 EF-hand_8 SHE3 ERM Dockerin_1 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 328949
NCBI-ProteinID: NP_001078842
MGI: 96930
Ensembl: ENSMUSG00000071856
Vega: OTTMUSG00000055565
UniProt: Q3TYX4 E9PWI3
Position
18 B3; 18 23.74 cM
AA seq 1003 aa AA seqDB search
MAAASACNSSGGSSDTSSTGEEERLRRLFQTCDGDGDGYISRNDLLMVCRQLSMEESVAE
IMNQLGSDENGKISFQDFTRCHTQLVREIRKEEGDLSMKSDMSSTKRLSERITSWPTSSD
NSLGALSAARESWEDDSGARDLQSPDLQSQRPLQKLLEYGGSSLPQQAVLHKLLTHAPNF
GTSTGGSYLELASTLHLAALASLKGDIVELNKRLQQTERERDLLEKKLAKAQCEQSHLMR
EHEDVQERTTLRYEERITELHSIIAELNKKIDRLQGTTIREEDEYSELRSELSQSQQEVN
EDSRSVDQDQTSVSIPENQSTMVTADMDNCSDLNSELQRVLTGLESVVCGRKKSSCSLSV
ADVDRHIEQLTTASEHCDLAIKTVEEIEGVLGRDLYPNLAEERSRWEKELAGLREENESL
TAMLCSKEEELNRTKATMNAIREERDRLRRRVRELQTRLQSVQATGPSSPGRLTPANRPI
NPSTGELSTSSSSNDIPIAKIAERVKLSKTRSESSSSDRPVLGSEISSIGVSSSVAEHLA
HSLQDCSNIQEIFQTLYSHGSAISESKIREFEVETERLNSRIEHLKSQNDLLTITLEECK
SNAERMSMLVGKYESNATALRLALQYSEQCIEAYELLLALAESEQSLILGQFRAAGVGSS
PGDQSGDENITQMLKRAHDCRKTAENAAKALLMKLDGSCGGAFAVAGCSVQPWESLSSNS
HTSTTSSTASSCDTEFTKEDEQRLKDYIQQLKNDRAAVKLTMLELESIHIDPLSYDVKPR
GDSQRLDLENAVLMQELMAMKEEMAELKAQLYLLEKEKKALELKLSTREAQEQAYLVHIE
HLKSEVEEQKEQRTRSLSSTSSSGKEKPGKECADAASPALSLAELRTNSDSELATEFANA
IRREKKLKARVQELVSALERLTKSSEIRHQQSAEFVNDLKRANSNLVAAYEKAKKKHQNK
LKKLESQMMAMVERHETQVRMLKQRIALLEEENSRPHTNETSL
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcaagcgcctgcaacagcagcggtggcagcagcgacacgtccagcaccggc
gaggaggagcgactgcggcggctcttccagacgtgcgacggcgacggcgatggctacatc
agcaggaatgacttgctaatggtctgcagacagctgagcatggaagagtcagtggctgag
atcatgaaccaattgggctcagatgaaaacgggaagatttccttccaagacttcacaagg
tgccacacgcagcttgttagagaaattaggaaggaggaaggagacctctccatgaaatca
gacatgtccagtacaaagaggctgagtgagagaatcacctcctggcccacgagcagtgac
aacagtctgggtgctttgtcagcagccagggagagctgggaggatgattctggtgccagg
gatctccagagcccggacttgcagagccagcggcccctccagaagctgctggagtatggc
ggaagctctttgcctcagcaggctgtgctccacaagcttctcacacacgccccgaatttt
ggcacctctacaggcggaagctatctagagctggccagcaccctccacttggcagccctg
gcatcactcaagggagacattgtagagctgaataagcgtctgcagcagacagagcgggaa
cgcgacctcctggaaaagaagttggccaaagcacagtgtgagcagtcacacctcatgaga
gagcatgaagacgtccaggagcgcacgacactccgctatgaggagcgcatcacagaactc
cacagtatcattgcagaactcaacaagaagatagaccgcctgcaaggtaccaccatcagg
gaggaagatgagtactcagaacttcggtcagagctcagccagagtcaacaagaggttaat
gaagactccagaagtgtggaccaagaccagacctctgtgtccatccctgagaaccagtct
actatggtcactgctgatatggataactgcagtgacttgaactcagaactgcagagggtg
ttgaccggtctggagagtgtcgtctgcggcaggaagaagagcagctgtagcctctctgtg
gccgacgttgacaggcacatagagcagctcaccacggccagcgagcactgcgacttggcc
attaagacagttgaggagatcgagggcgttctaggtcgcgatctgtatcccaacctggct
gaggagcggtcccggtgggagaaagagctggctggactgcgggaagagaacgaaagcctg
acggccatgctatgcagcaaagaggaggagctgaaccggaccaaggccactatgaacgcc
atccgtgaggagcgggacaggcttcggaggcgggtccgagagctccaaactcggctgcag
agtgtgcaggctactggaccttctagcccaggtcgcctcacccctgccaatcgcccaatc
aaccccagcaccggagagctaagcaccagcagtagcagcaatgacatccccatcgctaag
attgctgagagagtgaagctgtcaaagacgagatctgaatcgtcatcatctgataggcca
gtcctgggctcggaaatcagtagcatcggggtttccagcagtgtggcagaacacctggcc
cactcactccaggactgctccaacatccaggaaattttccagacactctactcacacgga
tctgccatctctgaaagcaagattagagagtttgaggtggaaacggaacgattgaatagt
cgtattgaacacctcaaatcccaaaatgaccttctcaccataaccctggaggaatgtaaa
agcaacgccgagaggatgagcatgctggtggggaagtacgaatccaacgccacagccctg
aggctggccttgcagtacagtgagcagtgcatagaagcctatgaactcctgctggccctg
gctgagagcgagcagagcctcatcctggggcaattccgagcagctggtgtgggctcctcc
cctggagaccagtcaggggatgaaaatatcactcagatgctcaagcgggctcatgactgc
cggaagactgctgagaacgccgccaaagccctgctcatgaagctggatggcagctgcggg
ggagccttcgccgtggctggctgcagcgtgcagccctgggagagcctgtcctccaacagc
cataccagcacgaccagctctacagccagcagctgtgacacagagttcactaaggaagat
gagcaaaggttgaaggattatatccagcagctcaagaatgacagagccgccgtcaagctg
accatgctggagctggagagcatccacatcgatccactcagctatgatgtcaagccaaga
ggcgacagccagaggctggacctggaaaatgccgtgctgatgcaggagctgatggccatg
aaggaggagatggctgagctgaaggcccagctctatctactggagaaggagaagaaagcc
ctggagctgaagctgagcacgagggaggcgcaggagcaggcctatctggtgcacatcgag
catctcaagtccgaggtggaggagcagaaggagcagaggacgcggtctctgagctccacc
agcagcagcggcaaggagaagcctggcaaggagtgtgccgatgctgcctctccagctttg
tcacttgccgaactaaggacgaacagcgacagtgagctggccaccgagttcgccaatgcc
atccgacgggaaaagaagctgaaggccagagtccaagaactggtcagtgccttggaaaga
ctaaccaaaagcagtgaaatcagacaccagcagtcagcagagtttgttaatgacctgaaa
cgggccaacagcaatctggtggctgcttacgagaaagcaaagaagaagcatcaaaacaag
ctgaagaagctggaatctcagatgatggccatggtggagcgacacgagacccaagtgaga
atgctcaagcaaagaatagccctgctggaggaagagaattccaggccacacaccaacgaa
acgtcactctaa

DBGET integrated database retrieval system