KEGG   Mus musculus (mouse): 329064Help
Entry
329064            CDS       T01002                                 

Gene name
Pkd2l1, B830002B15, BC046386, PCL, PKD2L, Pkdl, TRPP3
Definition
(RefSeq) polycystic kidney disease 2-like 1
  KO
K04990  polycystin 2L1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    329064 (Pkd2l1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   329064 (Pkd2l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel Ion_trans EF-hand_8 EF-hand_1 HBS1_N EF-hand_6
Motif
Other DBs
NCBI-GeneID: 329064
NCBI-ProteinID: NP_852087
MGI: 1352448
Ensembl: ENSMUSG00000037578
Vega: OTTMUSG00000033257
UniProt: A2A259
Structure
PDB: 

Position
19 C3; 19 36.91 cM
AA seq 760 aa AA seqDB search
MNSMESPKNQELQTLGNRAWDNPAYSDPPSPNRTLRICTVSSVALPETQPKKPEVRCQEK
TQRTLVSSCCLHICRSIRGLWGTTLTENTAENRELYVKTTLRELVVYIVFLVDICLLTYG
MTSSSAYYYTKVMSELFLHTPSDSGVSFQTISSMSDFWDFAQGPLLDSLYWTKWYNNQSL
GRGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDILNCYDVYSPDKEDQLPFGPQ
NGTAWTYHSQNELGGSSHWGRLTSYSGGGYYLDLPGSRQASAEALQGLQEGLWLDRGTRV
VFIDFSVYNANINLFCILRLVVEFPATGGTIPSWQIRTVKLIRYVNNWDFFIVGCEVVFC
VFIFYYVVEEILEIHLHRLRYLSSVWNILDLVVILLSIVAVGFHIFRTLEVNRLMGKLLQ
QPDTYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDILGF
AIMFFIVFFAYAQLGYLLFGTQVENFSTFVKCIFTQFRIILGDFDYNAIDNANRILGPVY
FVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDQLQLSDFLKQSYNKTLLRLRLRKE
RVSDVQKVLKGGEPEIQFEDFTSTLRELGHEEHEITAAFTRFDQDGDHILDEEEQEQMRQ
GLEEERVTLNAEIENLGRSVGHSPPGELGAEAARGQSWVSGEEFDMLTRRVLQLQCVLEG
VVSQIDAVGSKLKMLERKGELAPSPGMGEPAVWENLYNPS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtatggaaagccccaagaatcaggagctacaaaccctggggaacagagcctgg
gacaatcctgcctacagcgaccctccttccccgaacaggacgctgaggatctgcactgtc
tccagtgtggctctccctgagactcaacccaaaaagccagaagtcagatgccaggagaag
acacagagaaccctggtgtccagctgctgtctccatatctgtcggagcatcagaggactg
tgggggacaacgctgactgagaacacagccgagaacagggagctttatgtcaagaccacc
ctgagggagcttgtggtatacatagtgttcctcgtggacatctgtctgttgacctacgga
atgacaagttctagtgcctattactacaccaaagtgatgtctgaattgttcctacacacc
ccatccgactctggagtctccttccaaaccatcagcagcatgtcagacttctgggatttt
gctcagggcccactcctggacagtttgtactggacaaagtggtacaacaaccagagcctg
gggcgtggctcccactccttcatctactatgagaacctgctcctgggagccccaaggttg
cggcagctgcgcgtgcgcaatgactcctgtgtggttcatgaagacttccgggaggacatt
ttgaactgttatgatgtgtactcgccggacaaagaagatcagctcccctttggacctcag
aacggcacagcgtggacataccattcccagaatgagctgggtggctcctcccactggggc
aggctcacaagctacagcgggggtggctactacttggatcttccaggatcccgacaagcc
agtgcagaggccctccaaggactccaggagggactgtggctggacaggggcactcgggtg
gtctttatcgacttctccgtctacaatgccaacatcaatcttttctgtattctgagactg
gtggtagagtttccagccacaggagggaccatcccatcctggcagatccgcacagttaag
ctgatccgctatgtgaataactgggacttcttcattgtgggctgtgaagttgtcttctgt
gtcttcatcttctattatgtggtggaggaaatcctggaaatccacctgcatcggcttcgc
tacctcagcagcgtctggaacattctggacctggtggtcatcttgctctccatcgtggct
gtgggtttccacatattccgaaccctggaagtgaaccgactgatgggaaagcttctgcaa
cagccagacacgtatgcagactttgagttcctggccttctggcagactcagtacaataac
atgaacgcggtcaaccttttctttgcttggatcaagatattcaagtatatcagcttcaac
aagaccatgacacagctctcctccaccctggctcgctgtgccaaggacatcctgggcttt
gccatcatgttcttcattgtcttcttcgcttacgcccagcttggctacctgctttttggg
acccaagtggaaaactttagcactttcgtcaagtgcattttcactcagttccggataatc
cttggggattttgactacaatgccatcgacaatgccaacagaatcctgggccctgtgtac
tttgtcacctatgtcttcttcgtcttcttcgtgctcctgaacatgttcctggccatcatc
aacgacacatactccgaggtcaaggaggagctggctggccagaaggatcagttgcagctt
tctgacttcctgaaacagagctacaacaagaccctactaaggctgcgcctgaggaaagag
cgggtttctgatgtgcagaaggtcctgaagggtggggaaccagagatccagtttgaagat
ttcaccagcaccttgagggaactggggcacgaggagcacgagatcaccgctgccttcacc
aggtttgatcaggatggggaccacatactggatgaggaggagcaggaacagatgcggcag
ggactggaagaggagagggtgaccctcaatgctgagattgagaacctaggccggtctgtt
ggacacagccccccaggcgaattgggcgcggaggctgccagaggacaaagctgggtttct
ggagaagaattcgacatgctcacaaggagagttctgcagctgcagtgtgttctggaagga
gttgtgtcccagattgatgctgtaggctcaaagctgaagatgctggagaggaaaggggag
ctggctccctccccaggaatgggggaaccagctgtttgggagaacctgtataatccgtcc
tag

DBGET integrated database retrieval system