KEGG   Mus musculus (house mouse): 329252
Entry
329252            CDS       T01002                                 
Symbol
Lgr6, A530037C04Rik, D830026M09
Name
(RefSeq) leucine-rich repeat-containing G protein-coupled receptor 6
  KO
K08399  leucine-rich repeat-containing G protein-coupled receptor 6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    329252 (Lgr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    329252 (Lgr6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Others
   R-spondin
    329252 (Lgr6)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 LRR_9 LRRNT 7tm_1
Other DBs
NCBI-GeneID: 329252
NCBI-ProteinID: NP_001028581
MGI: 2441805
Ensembl: ENSMUSG00000042793
UniProt: Q3UVD5
Position
1:complement(134911038..135033112)
AA seq 967 aa
MHSPPGLLALWLCAVLCASARAGSDPQPGPGRPACPAPCHCQEDGIMLSADCSELGLSVV
PADLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLHSLKILM
LQSNQLRGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNHIRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLHNLETLD
LNYNELQEFPLAIRTLGRLQELGFHNNNIKAIPEKAFMGSPLLQTIHFYDNPIQFVGRSA
FQYLSKLHTLSLNGATDIQEFPDLKGTTSLEILTLTRAGIRLLPPGVCQQLPRLRILELS
HNQIEELPSLHRCQKLEEIGLRHNRIKEIGADTFSQLGSLQALDLSWNAIRAIHPEAFST
LRSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
AYGICASFFKTSGQWQAEDFHPEEEEAPKRPLGLLAGQAENHYDLDLDELQMGTEDSKPH
PSVQCSPVPGPFKPCEHLFESWGIRLAVWAIVLLSVLCNGLVLLTVFASGPSPLSPVKLV
VGAMAGANALSGISCGLLASVDALTYGQFAEYGARWESGLGCQATGFLAVLGSEASVLLL
TLAAVQCSISVTCVRAYGKAPSPGSVRAGALGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGRPAALGFAVALVMMNSLCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
LWPSPRSPGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGQPPGLETYGFPSVT
LISRHQPGATRLEGNHFVESDGTKFGNPQPPMKGELLLKAEGATLAGCGSSVGGALWPSG
SLFASHL
NT seq 2904 nt   +upstreamnt  +downstreamnt
atgcacagcccgcctgggctcctggcgctgtggctttgcgctgtgctgtgcgcatcggcg
cgcgcgggcagcgacccccagcctggcccggggcgtcccgcctgcccggctccctgccac
tgccaggaggacggcatcatgctgtccgctgactgctccgagctcgggctctcagtggtg
cctgcggacctggaccccctgacggcttacctagacctcagtatgaacaacctcacggag
cttcagccgggtctcttccaccacctgcgcttcctggaggagctgcggctctcagggaac
cacctctcacacatcccgggacaggcattctctggcctccacagcctcaaaattctaatg
ctgcagagcaaccagctccgtgggatcccagcagaggcactatgggagctgcccagcctg
cagtcgctgcgcctagatgctaatctcatctccctggtccctgagagaagctttgagggg
ctctcctccctccgccacctctggctggatgacaatgcactcaccgagatccccgtcaga
gctctcaacaaccttcctgccctacaagccatgaccttggctctcaaccatatccgccac
atccctgactatgccttccagaacctcaccagtcttgtggtgctgcatctacataacaac
cgcatccagcatgtggggacccacagcttcgaggggctgcacaatctggagacactagac
ctgaactataatgagctgcaggagttccccttggctatccggaccctgggcaggctgcag
gaattgggtttccataacaacaacatcaaggctatcccagagaaagccttcatgggcagc
cctctcctgcagacaatacatttttatgacaacccaatccagtttgtgggaaggtcagca
ttccagtacctgtctaaactgcatacgctatctttgaatggtgccactgatatccaagag
ttcccagacctcaaaggcaccactagcctggagatcctgaccctgacccgtgcgggcatc
agactgctcccaccgggagtgtgccaacagctgcctaggctccgaatcctggagctgtct
cataatcagatcgaggagttacccagcctgcacaggtgtcagaagctggaggaaattggc
ctccgacataaccggatcaaggaaattggtgcagataccttcagccagctgggctccttg
caagctttagacctgagttggaatgccatccgtgccatccaccctgaggctttctcaacc
cttcgatccttggttaagctggacctgactgacaaccagctgaccacactgcccctggct
gggctgggaggcctgatgcacctgaagctcaaagggaacttggccctgtctcaggccttc
tccaaggacagtttcccaaaactgaggatcctggaggtgccctacgcctaccagtgctgt
gcctacggcatctgtgccagcttcttcaagacctctgggcagtggcaggccgaggacttt
catccagaggaagaggaggcaccaaagaggcccctgggtctccttgctggacaagctgag
aaccactatgacctagacctggatgagctccagatggggacagaggactcaaagccacac
cccagtgtccagtgcagccctgttccaggccccttcaagccctgcgagcacctctttgag
agctggggcatccgccttgctgtgtgggccatcgtgttactctccgtactctgtaacggg
ctggtgctgctgacagtctttgccagcggacccagcccgctgtcccccgtcaagcttgtg
gtgggtgcgatggcaggcgccaacgccctgtcgggcatttcctgtggtctcctggcctcg
gtggacgccttgacctatggtcagttcgctgagtatggagcccgctgggagagcggtctg
ggctgccaggctacgggcttcctggctgtcctgggttcagaggcgtcggtgctgctgctc
acactggcggccgtgcagtgcagcatctccgtgacctgcgtccgagcctacgggaaggcg
ccgtcgcctggcagcgtccgcgcaggcgcactgggatgcctggcgctggccgggctggcc
gcagcactgccgctggcctcggtgggagagtatggcgcctccccactctgcctgccctac
gccccacccgagggccggccggctgccctgggcttcgctgtagccctggtgatgatgaac
tcgctctgcttcctggtggtggccggcgcctacatcaagctctactgtgacctgccacgg
ggtgactttgaggccgtgtgggactgcgccatggtgcgccacgtggcctggctcatcttt
gcagatggcctcctctactgccccgtggccttcctcagctttgcctctatgctgggcctc
ttccctgtcacccccgaggctgtcaagtcagtccttctggtggtgctgcctctgcctgcc
tgcctcaacccactgctctacctgctcttcaaccctcacttccgggatgaccttcggcgg
ctctggccaagccctcggtccccagggcccctagcctacgctgcagccggtgagctggag
aagagctcctgcgactccacccaagcgctggtggctttctcagatgtggatcttattctg
gaagcttctgaggctgggcagcctcctgggctagagacctatggcttcccttcagtgacc
ctcatctcccgacatcagccgggggctaccaggctggagggaaaccattttgtagagtct
gatggaaccaagtttgggaacccacaacctcccatgaagggagaactgctgctgaaggca
gagggagccactttggcaggctgtggctcttccgtgggtggagccctctggccctctggc
tctctctttgcctctcacttgtaa

DBGET integrated database retrieval system