KEGG   Mus musculus (mouse): 329470Help
Entry
329470            CDS       T01002                                 

Gene name
Accs, 2610203E10Rik, Phacs
Definition
(RefSeq) 1-aminocyclopropane-1-carboxylate synthase (non-functional)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 329470
NCBI-ProteinID: NP_001277711
MGI: 1919717
Ensembl: ENSMUSG00000040272
Vega: OTTMUSG00000014985
UniProt: A2AIG8
Position
2; 2 E1
AA seq 502 aa AA seqDB search
MFCLPQQESTAPTTCTGSASTQDMDSGYGDGLQGECLRKPDQTQPKLYGVGDPTATFSSD
SSCLSSRGRVIKWFWDSAEEGYRTYHMDEYDEDKNPSGIINLGTSENKLCFDLLSWRLTQ
GDMLHVEPSLLQYPDWRGHLFLREEVAKFLSFYCKSPAPLKPENVVVLNGCASLFSALAT
VLCEAGEALLIPTPYYGAITQHIYLYGNVRLAYVYLDSKVTGLNTRPFQLTVEKLEMVLQ
GVSSEGVKVKGLILINPQNPLGDVYSPEELQDFLRFAMRHKLHVIMDEVYMLSVFEESLG
YRSVLSLERLPDPQRTHVMWATSKDFGMSGLRFGVLYTENQHVATAVASLCRYHGLSGLV
QHQMAQLLRDHDWISQVYLPENHARLKAAHTYVSEELRALGIPFVSRGAGFFIWVDLRKY
LCKGTFEEEALLWRQFLDNKVLLSSGKTFECKEPGWFRVVFSDKENRLRLGMQRMRQVLE
GQSQVVEDASPCHAQEPQSQPR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtcttcctcagcaggaatccacggcacctactacctgcacaggctcagcctcc
actcaggacatggacagtggctatggtgatggcctgcaaggagaatgcctcagaaaacca
gaccagacgcagcccaaactctatggagtaggtgaccccacggccacgttctcctctgac
agctcctgcctgtcctccagaggaagagtcatcaaatggttctgggactcggctgaggag
ggctacaggacctaccacatggatgagtatgacgaggacaagaaccccagtggcatcatt
aacttgggcaccagtgaaaacaaactctgctttgaccttctgtcctggcggctgacacag
ggtgacatgcttcatgtggaaccatctctgctgcagtaccctgactggagaggacatttg
ttcctccgggaagaagtggcaaagttcttgtctttctattgtaagagcccggcacccctg
aaaccagagaatgtggttgttctgaatggctgtgcctctctcttttccgctctggccaca
gtgctgtgtgaggcaggggaggctctcttgatccccacaccttactacggagccatcact
cagcacatctatctctatggcaacgtccgactggcttatgtctacctagacagcaaggta
actggattgaatacacgccccttccagctcaccgtagagaagctggagatggtcctgcaa
ggagtcagttctgagggtgtcaaggtcaaaggccttatcctcatcaacccccaaaaccct
ctgggtgacgtctactccccggaagagctgcaggactttctgagatttgccatgaggcac
aagctgcacgtgatcatggatgaggtttacatgctctctgtgtttgaagagtcccttggc
taccgcagtgtcctcagcctggagaggctgcctgacccccagaggacacacgtgatgtgg
gccaccagcaaggactttgggatgtcggggctacgcttcggtgtactgtacacggagaac
cagcacgtggctactgctgtggcctccctctgccgctatcatggcctcagtggcctggtc
caacaccagatggcacagctgctccgggaccatgactggatcagccaggtgtacctgcca
gaaaaccatgcccggctcaaggctgcccacacctatgtctcagaggaactcagagccctg
gggatcccctttgtgagtcgcggggcaggcttcttcatctgggttgacttgagaaagtat
ctgtgcaaaggcacctttgaggaggaggcgttattgtggcgccaatttttggacaacaag
gtgctgctgtcctccggtaagacctttgagtgcaaagaacccggctggttccgcgtggtc
ttctcggacaaggagaaccggcttcgcctgggaatgcaaaggatgcggcaggtgcttgaa
ggacaatctcaagtggtagaagatgcctctccctgtcacgctcaggaaccacaaagccag
cccagatga

DBGET integrated database retrieval system