KEGG   Mus musculus (mouse): 329506Help
Entry
329506            CDS       T01002                                 

Gene name
Ctdspl2, D2Ertd485e, SCP4
Definition
(RefSeq) CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2
  KO
K17616  CTD small phosphatase-like protein 2 [EC:3.1.3.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    329506 (Ctdspl2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     329506 (Ctdspl2)
Protein phosphatases and associated proteins [BR:mmu01009]
 HAD phosphatases
  Fcp/Scp phosphatases
   329506 (Ctdspl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NIF
Motif
Other DBs
NCBI-GeneID: 329506
NCBI-ProteinID: NP_997615
MGI: 1196405
Ensembl: ENSMUSG00000033411
Vega: OTTMUSG00000015440
UniProt: Q8BG15
Position
2 E5; 2 60.46 cM
AA seq 465 aa AA seqDB search
MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGST
PKEERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGEAGSYEMTNQHI
KQNGKLEDNPCSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLD
MEQVDEITTSTTSANGAAYSNQAVQVRPSLNNGLEEAEETVTRDIPPLTAPVTPESGYSS
AHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHC
SLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLN
ILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIE
SWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgagaacacggaaggcttctcagcagtccagtccaatccagacacagcgcact
gccagagcaaagaggaaatactcagaggttgatgatagcttgccttcaggaggagaaaaa
ccatcaaagaatgaaaccggcttattgtcttcaattaaaaagttcattaaaggaagcaca
cccaaggaagagagagaaaatccttcgaagcggagtagaattgaacgtgatatagataat
aatttaatcacatcaacaccaagaaccggagaaaagcctgacaaacagttgtctcgagta
agacggaaaagtccagtcaatggagaagctggtagttatgaaatgacaaatcaacatata
aagcaaaatggaaaattagaagataacccttgctctggtagtcctccgaggactacattg
ttggggaccatattttcgcctgtcttcaactttttttcaccagcaaataaaaatggaacg
tcaggctcagattccccaggacaggctgtggaagctgaggagatagtgaaacaacttgac
atggaacaggtggatgaaattactaccagcaccacgtcagctaatggagcggcttactca
aatcaagcagttcaagtgaggccatcactaaataatggtttagaagaagcagaagaaaca
gttacccgggatatcccaccccttacagcaccagtaactccagagagtgggtactcgtca
gcccatgcagaggccacctatgaagaagactgggaagtatttgacccctattatttcatc
aaacatgttccgcctctgacagaagaacagctaaataggaaacctgctcttcctttgaaa
acaagaagcacaccagagttctccctggtcttagatctggatgagacactagtgcactgc
agtctgaatgagctagaagatgcagcgctcacttttccagtccttttccaagatgtcatt
tatcaggtttatgtgagattaagaccattcttcagggaattcctggaacgaatgtctcag
atgtatgagatcattctttttactgcttctaagaaggtgtatgcagacaagttactgaac
atactagaccctaaaaagcaactggtcaggcaccggcttttccgtgaacattgtgtttgt
gtacaaggaaactatataaaggacttgaatatccttgggagagatctttccaaaactata
ataattgacaactcaccacaagcctttgcctatcagctttctaatggaatccctatagaa
agctggtttatggataaaaatgacaatgaactcctaaaattgattccatttctggagaag
cttgtagaactgaatgaagatgtccggcctcacatcagagacagatttcgattgcatgat
ttgctgcccccagattaa

DBGET integrated database retrieval system